(data stored in ACNUC7421 zone)

EMBL: CP000667.PE377

CP000667.PE377       Location/Qualifiers
FT   CDS_pept        complement(434805..435221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0377"
FT                   /product="putative transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52862"
FT                   /db_xref="GOA:A4X1W2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W2"
FT                   /protein_id="ABP52862.1"
FT                   /translation="MASGEGTAQAAFARFVRRAIDNARMERGWTVTDLAAQTGIGRSTV
FT                   FRWLAGDWHDYPELAKVRGFCVALDLPVAAAFRALGLPEAGSALPRRGNDGPVEADVRA
FT                   ILERLADPAVSVEEKHHIRDLLRYLAQRPIRQPE"
     atggcttcgg gagagggaac cgcacaggcg gcgttcgccc gcttcgtccg ccgcgccatc        60
     gacaatgccc gcatggagcg cggttggacg gtgaccgacc tggcggccca gaccgggatc       120
     ggccgctcca ccgtcttccg ctggctcgcc ggcgactggc atgactaccc tgagctggcc       180
     aaggtgcggg gcttctgcgt cgcgctcgac ctacccgtcg ccgccgcgtt ccgcgctctc       240
     ggcctgccgg aggccggttc cgcactgcct cggcgcggca atgacggacc ggtcgaggcg       300
     gatgtccggg cgatcctcga gcgcctcgcc gacccggcgg tgtcggtgga ggagaagcac       360
     cacatccggg acctgctgcg ttacctggcc cagcggccga tccgccagcc agagtga          417
//

If you have problems or comments...

PBIL Back to PBIL home page