(data stored in ACNUC7421 zone)

EMBL: CP000667.PE381

CP000667.PE381       Location/Qualifiers
FT   CDS_pept        complement(439183..439821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0381"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52866"
FT                   /db_xref="GOA:A4X1W6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W6"
FT                   /protein_id="ABP52866.1"
FT                   /translation="MTAVGNGTQTAGRPTRLPRSARRRQLLAAAQEVFVAQGYHAAAMD
FT                   DIAERAGVSKPVLYQHFPGKMELYLALLDTHCDMLVATVQEAMRGTLDNKERVSASVRA
FT                   YFDFVDHESESFRLVFESDLRNDPAVRQRVERVEQGCIAAITDTIISDTGVSRAHAELL
FT                   ASGLVGAAETAAQFWLARGRQVPKGEAEALVAALSWRGIASFPLQGESA"
     atgaccgctg tggggaacgg tacccagacc gccggccggc ccacccgcct gccccggtcc        60
     gcccgccgca gacagttgct cgccgcggcg caggaggttt tcgtcgcaca gggctaccac       120
     gcggccgcga tggacgacat cgccgaacgc gcaggggtct ccaagccggt gctgtaccag       180
     cacttccccg gcaagatgga gctctacctg gcgctgctcg acacgcactg cgacatgctc       240
     gtggcgacgg tgcaggaagc gatgcgcggc accctcgaca acaaggagcg ggtgagcgcc       300
     tccgtccgcg cgtacttcga cttcgtcgac catgagagtg agtcgttccg cctggtcttc       360
     gagtccgacc ttcgtaacga ccccgcggtc cgccagcggg tcgagcgggt cgagcagggc       420
     tgcatcgcgg cgattaccga cacgattatc tcggataccg gcgtgagccg ggcacacgcg       480
     gagctactcg cgtccggcct ggtcggggcg gccgagacgg cggcgcagtt ctggctggcc       540
     agagggcggc aggtgccgaa gggagaggcg gaggcgttgg tcgccgcgct ctcctggcga       600
     ggcatcgcga gcttcccctt gcagggtgag tcagcctga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page