(data stored in ACNUC7421 zone)

EMBL: CP000667.PE383

CP000667.PE383       Location/Qualifiers
FT   CDS_pept        442332..443513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0383"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   Rhodanese domain protein; MoeZ/MoeB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52868"
FT                   /db_xref="GOA:A4X1W8"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1W8"
FT                   /protein_id="ABP52868.1"
FT                   /translation="MSLPPLVEPAAELTVDEIRRYSRHLIIPDVGVEGQKRLKNARVLC
FT                   VGAGGLGSPALMYLAAAGVGTLGIVDFDTVDESNLQRQIIHGVSDVGRAKAESASASIR
FT                   EINPLVEVKIHNTALDRDNVKEIFAQYDLIVDGTDNFATRYLVNDAAVLLGKPYVWGSI
FT                   YRFDGQASVFWAEHGPCYRCLYPEPPPPGMVPSCAEGGVLGVLCASIGSIQVNEAIKLL
FT                   AGVGESLVGRLMVYDALEMSYRKIKVRKDPNCALCGENPTVTDLLADYEDFCGAVSTEA
FT                   QEAVVDATVTAGELKAWQDAGKEIFLVDVREPAEFEIVRIPGSTLIPKGDIVSGHALGK
FT                   LPQDRQIVLHCKSGVRSAEALAALKAAGFRDAVHLQGGVLSWIRQVDPSLPAY"
     gtgtcgctgc ccccgctcgt cgagcccgcc gccgagctga ccgttgacga gatccgccgc        60
     tactcgcgcc acctgatcat cccggatgtc ggggttgagg ggcagaagcg gttgaagaac       120
     gcccgggtgc tctgtgtcgg cgccggcggc ctcggttctc cggcgctgat gtacctcgcc       180
     gccgccgggg tgggcacgct cggcatcgtc gacttcgaca ccgtcgacga gtccaacctc       240
     caacgtcaga tcatccacgg cgtctccgac gttggccgcg ccaaggcgga atcagcctcc       300
     gccagcatcc gtgagatcaa cccgttggtc gaggtaaaga tccacaacac cgcgttggac       360
     cgggacaacg tcaaggagat cttcgcccag tacgacctga tcgtggacgg caccgacaac       420
     ttcgccaccc ggtacctggt caacgacgcg gcggtgctgc tcggcaagcc gtacgtgtgg       480
     gggtccatct accggttcga cgggcaggcc tcggtgttct gggccgagca cggtccctgc       540
     taccgctgcc tctacccgga gcctcctccg cccggcatgg tgccctcctg cgcggagggc       600
     ggcgtgctcg gcgtgctctg cgcgtcgatc ggctcgattc aggtgaacga ggcgatcaag       660
     ctcctcgccg gtgtcggtga gtcgctggtc ggccgactca tggtctacga cgccctggag       720
     atgagctacc gcaagatcaa ggtgcggaag gatccgaact gcgctctctg cggcgagaac       780
     cccacggtca ccgacctgct ggccgactac gaggacttct gcggtgcagt gtcgaccgag       840
     gcccaggagg ccgtggtgga cgcgacggtc accgccggcg agctgaaggc gtggcaggac       900
     gccggcaagg agatcttcct ggttgacgtg cgggagccgg ccgagttcga gatcgtccgg       960
     atcccgggct ccacgctgat tcccaaggga gacatcgtct ccgggcacgc gctggggaag      1020
     ctcccgcagg accgacagat cgtgctgcac tgcaagtccg gcgtccggtc cgcggaggcg      1080
     ctcgccgcgc tgaaggccgc cggcttccgg gacgcggtgc acctccaggg gggtgtcctc      1140
     tcctggatca ggcaggtcga tccgtcgttg cccgcgtact ga                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page