(data stored in ACNUC7421 zone)

EMBL: CP000667.PE386

CP000667.PE386       Location/Qualifiers
FT   CDS_pept        complement(445835..446992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0386"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="TIGRFAM: glutamate 5-kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; PUA domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52871"
FT                   /db_xref="GOA:A4X1X1"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1X1"
FT                   /protein_id="ABP52871.1"
FT                   /translation="MGTGPSVDQPTPQNGQVRDSVRAARRVVVKIGSSSLTTADGGLDD
FT                   GRVDALVDTLGTLAAQGREVVLVSSGAIAAGLAPLGLTRRPRDLATQQAAASVGQGLLI
FT                   RRYAAAFARHRRTVGQVLLTVDDMTRRAHYRNAYRTLRKLLDLGAVPIVNENDTVATEE
FT                   IRFGDNDRLAALVAALVDTDLLLLLSDVDALWTGDPTRPGSTRIAEVRDERDLSGVAIG
FT                   GAGRAGVGTGGMVTKVEAARIATGFGIPVILTSADQAAEALDGKPVGTFFHPSQRRPTA
FT                   RLFWLAHATSPRGRLQLDPGAVAAVVDRRKSLLPAGITAVRGAFTAGDPVDLVDTDGVP
FT                   VARGLVNYDAVELPGLLGRSTAELATALGPAYEREVVHCDDLVLL"
     atgggaaccg gtccgagcgt ggaccaaccg acaccgcaga atgggcaggt gcgcgacagt        60
     gtgagggcgg cccggcgggt ggtcgtcaag atcggttctt cctcgttgac cacggccgac       120
     ggcggcctgg atgacgggcg ggtcgacgcg ctcgtggaca ccctcggcac cctcgccgcc       180
     cagggccggg aggttgtgct ggtctcctcc ggcgcgatcg ccgcggggct ggccccgctg       240
     gggctgaccc gccgcccccg tgacctggcc acccagcagg ccgccgccag cgttggccag       300
     gggctactga tccgacggta cgccgccgcc ttcgcccggc accgacgcac cgtcggtcag       360
     gtgttgctca ccgtggacga catgacccgg cgggcgcact accgcaacgc gtaccggacc       420
     ctgcgcaagc tactcgacct gggcgcggtg ccgatcgtca acgaaaacga cacggtcgcc       480
     accgaggaga tccggttcgg cgacaatgac cggctcgctg ccctggtggc tgccttggtc       540
     gacaccgatc tactacttct gctctccgat gtggacgcgc tttggaccgg agatccaacc       600
     cgccccggat cgacgcggat cgccgaggtc cgcgacgagc gggacctgtc cggggtggcg       660
     atcggcggtg ccggccgggc cggtgtcggc accgggggca tggtgaccaa ggtggaggcc       720
     gcccggatcg ccaccggctt cggcatcccg gtaatcctga cctctgccga ccaggcggcc       780
     gaggcgctgg acgggaagcc ggtcggcacc ttcttccatc ccagtcaacg ccggccgacc       840
     gcccggctgt tctggctggc gcacgccacc tcaccccgcg gccggctaca gctggacccg       900
     ggcgcggtcg cggccgtcgt cgaccggcgc aagtcgctgc tacccgcggg gatcaccgcg       960
     gtgcggggcg ccttcaccgc aggcgatccg gttgacctgg tcgacaccga cggtgtgccg      1020
     gtggcccgcg ggctggtcaa ctacgacgcg gtggagttgc ccggtctact cggacgctcc      1080
     accgctgagc tcgccacggc ccttggccca gcctacgagc gggaggtcgt ccactgcgat      1140
     gacctggtgc tgttgtaa                                                    1158
//

If you have problems or comments...

PBIL Back to PBIL home page