(data stored in ACNUC7421 zone)

EMBL: CP000667.PE391

CP000667.PE391       Location/Qualifiers
FT   CDS_pept        complement(451061..452107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0391"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase, zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52876"
FT                   /db_xref="GOA:A4X1X6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR031640"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1X6"
FT                   /protein_id="ABP52876.1"
FT                   /translation="MRAVTVSPRIPGSLCLVEDWPEPAVEEGGILVEALAVGVCGTDQD
FT                   IIAGHFGEAPPGQEQLVIGHESLGRVLEDPTGTLHRGDLVAAIVRHPDPVPCLNCAVDE
FT                   WDMCRNGLFTEHGIKGLPGFARERWRVQPRFAVPLGAAFARVGMLLEPTSIVAKAWEHI
FT                   ERVGHRARWDPRTTLITGAGPIGLLAALLATQRGLTVHVLDRNTTGPKPDLVRALGATY
FT                   HTESVNEVDLQPDVLVECTGDPRVVLDSMCKVGPTGIVCLTGMSTGGRTIDFDAGALNR
FT                   TLVLENTVVIGSVNSNRRHWEQAAAALARADHSWLDALITHRIPMSDFTTAYEVNDGTI
FT                   KVVLDLTA"
     atgcgcgcgg tgacggtttc tccccgaatc cccggctcgc tctgcctggt cgaggactgg        60
     cccgagccgg ctgtcgagga gggcgggatc ctggtcgagg cgctggcggt gggggtctgc       120
     gggaccgacc aggacattat cgccggccat ttcggcgagg caccccccgg ccaggagcag       180
     ctggtcatcg ggcacgagtc gctcggccgg gtgttggagg acccgacggg caccctgcac       240
     cgcggggacc tggtggccgc gatcgtgcgg catcccgacc cagtgccctg cctgaactgc       300
     gccgtggacg agtgggacat gtgtcgcaac gggctgttca ccgagcacgg catcaaaggg       360
     ctccccggct tcgcgcggga acggtggcgg gtgcagccga ggttcgcggt gccgctcggt       420
     gccgccttcg cccgggtggg gatgctgctg gaacccacca gcatcgtcgc caaggcgtgg       480
     gaacacatcg agcgggtcgg ccaccgcgcc cgctgggacc cacggaccac cctgatcacc       540
     ggtgccgggc cgatcggcct gctcgccgcg ctgctcgcca cccaacgtgg actgaccgtg       600
     cacgtactgg accgaaacac gacggggccg aagccggacc tggtccgagc gctcggtgcc       660
     acgtaccaca ccgagtcggt caacgaggtg gacctccagc cggatgtgct ggtggagtgc       720
     actggcgacc cgagggtggt gctggactcg atgtgcaagg ttggcccgac cggcatcgtc       780
     tgcctgaccg gcatgtccac cggtggtcgg accatcgact tcgacgccgg ggcgctgaac       840
     cgaacgctcg tgttggagaa caccgtggtc atcgggtcgg tcaactccaa ccgccggcac       900
     tgggaacagg ccgcggcggc gctggcccgg gccgatcact cgtggctgga cgccctgatc       960
     acccaccgga taccgatgtc cgacttcaca accgcgtacg aggtcaacga cgggaccatc      1020
     aaggtggtcc tggacctcac cgcctga                                          1047
//

If you have problems or comments...

PBIL Back to PBIL home page