(data stored in ACNUC7421 zone)

EMBL: CP000667.PE392

CP000667.PE392       Location/Qualifiers
FT   CDS_pept        452287..452892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0392"
FT                   /product="NADH dehydrogenase (ubiquinone), 30 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone), 30 kDa
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52877"
FT                   /db_xref="GOA:A4X1X7"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1X7"
FT                   /protein_id="ABP52877.1"
FT                   /translation="MTLDEVGQRMAALLAPVEVTTSVSGGQAYARATVDVPAESWHDAL
FT                   RAARDDDELACDFFDWLSAVDELAAGFDVVVHLWSSTRRHGLLLRTRVPRAAPRVASVV
FT                   DIYPGAAWHERETHEMFGIDFADHAGLKPLLLPPEFEGHPLRKEFVLASRVAKPWPGAK
FT                   EPGEAKAGGGRRPMRPPGVPAPGEWGPAPTATESGGTA"
     atgactctgg acgaggtagg ccagcggatg gccgcgttgc tcgccccggt cgaggtcacc        60
     acctcggtct ccggcggtca ggcgtacgcc cgagccaccg ttgacgtgcc cgcggagagc       120
     tggcacgacg cactacgcgc ggcccgggac gacgatgaac tggcctgtga cttcttcgac       180
     tggctctctg cggtggacga gttggccgcc gggttcgacg tggtggtgca cctgtggtcc       240
     agtacgcgtc ggcacgggct gctgctgcgc acccgggtgc cccgcgcggc accgcgggtc       300
     gcctcggtgg tcgacatcta tccgggtgcg gcatggcacg agcgcgagac acacgagatg       360
     ttcggcatcg acttcgccga ccacgccggc ctgaagccgc tgctgctgcc cccggagttc       420
     gagggccatc cgctgcgtaa ggagttcgtc ctcgcctccc gggtggccaa gccctggccg       480
     ggggcgaagg agccgggtga ggccaaggct ggtggcggtc gtcggccgat gcgcccgccc       540
     ggcgtgccgg caccggggga gtggggtccg gcaccgactg ccacggagag tggggggacg       600
     gcctga                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page