(data stored in ACNUC7421 zone)

EMBL: CP000667.PE394

CP000667.PE394       Location/Qualifiers
FT   CDS_pept        453881..454846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0394"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52879"
FT                   /db_xref="GOA:A4X1X9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1X9"
FT                   /protein_id="ABP52879.1"
FT                   /translation="MTPRKLGYLYGIGAYVLWGFFPLYMRLLRPASPLEILAHRIVWSV
FT                   VFVALVLAAMRNRSFLRALLRRPRALAALGIAAALVALNWGTYIYGVNSERVVETSLGY
FT                   FVNPLVVVLLGVFVLRERLRPAQWAAIGVGGAAVVVLTVDYGRPPYLALVLSFTFAGYG
FT                   LVKKRLGLPAAQGLFVESAVLALPALAYLAWLGGTGGATFGAVSAGHTALLISAGAATA
FT                   IPLLMFAGAANRLPFTSLGMLQYLAPILQLGCGVIIFREPMPPARLAGFALVWLALAVF
FT                   TVDAVRAARRLPPPLADEVLAAVQPGSGTSPQQERKIVSG"
     gtgacgcctc gcaagctcgg ctacctgtac ggtatcggcg cgtacgtgct ctggggtttc        60
     ttcccgctct acatgagact gctccggccg gccagcccgc tggagatcct ggcccaccgg       120
     atcgtctggt cagtggtctt cgtcgcgctg gtactggcag caatgcgcaa ccgcagcttc       180
     ctgcgagcgc tgctgcgcag accgcgtgcc ctggccgcgc tcggcatcgc tgccgctctg       240
     gtcgccctca actggggcac ctacatctac ggggtcaact ccgagcgggt ggtggagacg       300
     tccctcggat acttcgtcaa cccgctcgtc gtggtgctac tcggagtctt cgtactgcgg       360
     gagcggctgc gccccgcgca gtgggcggcg ataggcgtgg gtggggcggc ggtcgtggtg       420
     ctgaccgtcg actacggccg cccaccgtac ctggcgctgg tcctctcgtt caccttcgcc       480
     gggtacgggc tggtcaagaa gcgcctcggc ctgcccgccg cccagggcct cttcgtcgag       540
     tcggcagtac tcgccctgcc cgcgctcgcg tacctggcat ggcttggtgg caccggcggg       600
     gccacgttcg gggcggtgtc ggcgggacac accgccctgt tgatctcggc cggagcagca       660
     accgcgattc ccctgctgat gttcgctggt gcggccaacc gactgccgtt caccagcctc       720
     gggatgctcc agtatctcgc cccgattctc caactcggct gcggcgtcat catcttccgc       780
     gagcccatgc ctcccgctcg cctggcgggc ttcgccctgg tctggctcgc gcttgccgtc       840
     ttcaccgtcg atgctgtccg cgccgcccgc cgcctccccc ctcccttagc agatgaagtc       900
     ctggccgcgg ttcaacccgg atcgggtact tcacctcagc aggagcgcaa gattgtttca       960
     ggctga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page