(data stored in ACNUC7421 zone)

EMBL: CP000667.PE396

CP000667.PE396       Location/Qualifiers
FT   CDS_pept        complement(455942..457216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0396"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region, ATPase domain protein
FT                   domain protein; histidine kinase, dimerisation and
FT                   phosphoacceptor region"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52881"
FT                   /db_xref="GOA:A4X1Y1"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Y1"
FT                   /protein_id="ABP52881.1"
FT                   /translation="MTSAAVSEHSWLLPGTLTAPTARARRTLRDWFVDSLCFLAAFGWA
FT                   VVAWDNSLSAEPAMAMNVGPSWLNEVDFLASLVLCGALWVRRRWPVGLALASLPLALFT
FT                   VSGDVALLIILFTVSVHRPFPVAASMFGVHLLAIPIYLWLRHDPVMSLWLTVGWILLCL
FT                   GAVLAWGMFVRARRQLVVSLRERAHRAEAEQQLRVTQARQLERTRIAREMHDVLAHRIS
FT                   LLSLHAGALEFRPDASPEEVARAAGVIRGSAHAALRDLREVIGVLRAETGVAEGAEPER
FT                   PQPTLVDVPTLISESRAAGVRVSFVEEVADQVELPPRVGRSVYRIVQEGLTNARKHAPG
FT                   VVVDVRLTGRQGDGLTVEIRNPWPVGVAGQGVGSPAARSGTDIPGAGTGLVGVAERVGL
FT                   AGGRLEYGRDAGGHFRLAAWLPWPA"
     gtgaccagcg ccgccgtatc cgaacactcc tggctcctac cgggcactct gacggccccc        60
     acggcccggg cccggcggac actgcgggat tggttcgtcg acagcctttg cttcctggcc       120
     gccttcggct gggcggtggt ggcgtgggac aattcgctgt cggccgagcc ggcgatggca       180
     atgaacgtcg gaccgagctg gctcaacgag gtcgacttcc tggccagcct ggtgctctgc       240
     ggtgctctct gggtccgtcg gcgctggccg gtgggtctgg cgctggccag cctgccgctg       300
     gcgttgttca cggtcagtgg cgacgtggcg ctgctgatca ttctgttcac ggtgagcgtg       360
     caccggccgt tcccggtcgc cgccagcatg ttcggtgtac acctgctcgc cataccgatc       420
     tatctgtggc tacgccacga cccggtgatg tcgctgtggt tgaccgtggg ttggatcctg       480
     ttgtgcctcg gggccgtgct ggcgtggggc atgttcgtcc gggcacgtcg gcagctggtg       540
     gtgtcgctgc gggagcgggc gcaccgggcc gaggctgagc agcagctgcg agtgacgcag       600
     gctcgacagt tggaacgtac tcgcatcgcc cgggagatgc atgatgtgtt ggcgcaccgc       660
     atctcgttgc tcagcctgca cgctggagca ctggaattcc gtccagatgc ctcgcccgag       720
     gaggttgcca gggcggccgg agtgatccgg ggcagcgcac acgctgccct gcgggacctg       780
     cgggaggtga tcggggtact ccgggcggag accggagtgg cggagggcgc cgaaccggaa       840
     cgacctcagc ccaccctcgt cgacgtgccg acgctgatca gcgagtctcg agccgccggt       900
     gtccgggtga gtttcgtcga ggaagtcgcc gaccaggtgg agctgccgcc cagggtgggg       960
     cgcagcgtgt accggatcgt gcaggagggg ctgaccaacg cccgcaagca cgccccgggt      1020
     gtggtggtcg acgtgcggct caccgggcga cagggcgacg ggctcactgt cgagatccgc      1080
     aacccctggc cggttggcgt agcggggcag ggcgtgggaa gccccgcggc ccgttctggt      1140
     actgatattc ccggtgccgg gactgggctt gtcggtgtgg ccgagcgggt cggtctggca      1200
     ggcgggcggt tggagtacgg acgggacgcg ggtgggcatt tccggctcgc tgcgtggctg      1260
     ccatggccgg cctga                                                       1275
//

If you have problems or comments...

PBIL Back to PBIL home page