(data stored in ACNUC7421 zone)

EMBL: CP000667.PE398

CP000667.PE398       Location/Qualifiers
FT   CDS_pept        458245..459030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0398"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52883"
FT                   /db_xref="GOA:A4X1Y3"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Y3"
FT                   /protein_id="ABP52883.1"
FT                   /translation="MTLTAEPTTEADSRVAAVRPSIARLTSIELRKLTDTRAGRWLLAT
FT                   IGLIAVAIAVVQLFVLDDAEQTFTGFLAPSLLPVGLLLPVVGILSITSEWTQRTALTTY
FT                   ALVPHRERVVLAKLAAVVLAALASVLVSLAVAAAGTLAAKATGGAGSWDGEWALVLHAA
FT                   VIQLVNVLMGAAFGLLLLNTPLAIVGYLLLPTVWSILAAMISALQGPANWLDTSVTMEP
FT                   LFGNEMTAGQWGRLAVSVLVWVAVPLVAGLLRTLRREVS"
     gtgaccctga ccgccgagcc caccaccgag gcggactccc gcgtcgcggc cgtcaggccg        60
     tccatagccc gactgacctc gatcgagcta cgcaagctca ccgacaccag ggccggccgc       120
     tggctgctgg ccaccatcgg gctgatcgcg gtcgccatcg ccgtggtgca gctgttcgtg       180
     ctggacgacg cggagcagac cttcaccggc tttctcgctc cgtcgctgct cccggtgggc       240
     ctgcttttgc cggtggtcgg catcctgtca atcacctcgg agtggacgca gcgcaccgcg       300
     ctgaccacat acgccctggt cccacatcgg gaacgggtgg tgctggccaa actcgcggcg       360
     gtggtactgg cggcactcgc gtcagtgctg gtgagcctgg ccgtggccgc cgccggcacc       420
     ctcgccgcca aggccaccgg tggcgcggga agctgggacg gcgagtgggc gttggtacta       480
     cacgcggccg tgatccagtt ggtcaacgta ctgatggggg ccgcgtttgg cctgctgctg       540
     ctcaacaccc cgctggcgat cgtcggctat ctgctgctgc cgacggtctg gagtatcctc       600
     gccgcgatga tctcggcgct acagggccca gccaactggc tcgacacctc ggtcaccatg       660
     gaaccgctct ttggcaatga gatgaccgcc gggcagtggg gccggctggc ggtctcggta       720
     ctggtctggg tggccgtgcc cttggtcgcc ggcctgctgc ggaccctgag gcgggaggtt       780
     tcctga                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page