(data stored in ACNUC7421 zone)

EMBL: CP000667.PE399

CP000667.PE399       Location/Qualifiers
FT   CDS_pept        complement(459178..460239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0399"
FT                   /product="glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52884"
FT                   /db_xref="GOA:A4X1Y4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Y4"
FT                   /protein_id="ABP52884.1"
FT                   /translation="MTEGATANSGEAALRRTGGRYVEPGGEFTRDQRYIATRITADGGD
FT                   GWPVEPGRYRLAVSRACPWANRLVIVRRLLGLEGVLSMAIAGPTHDRRSWSFDLDPGGR
FT                   DPVLDIERLAEAYFARFPGYDRGITVPAIIDVPTGQVVTNDFGQMSLDLSTQWTAYHRD
FT                   GAPELYPQRLRDEIDEVNGVVFADVNNGVYRCGFAGSQSAYDRAYRRLFDRLDWLSDRL
FT                   AERRYLVGETITEADVRLFTTLVRFDPVYHGHFKCNRSKLTEMPVLWAYARDLFQTPGF
FT                   GDTIDFDHIKRHYYEVHGDLNPTGIVPLGPDLANWLTPHGRGELGGRPFGDGTAPPPPP
FT                   PAERVDPAHTPLR"
     gtgaccgagg gcgcgacggc gaacagcggc gaggcggcac tgcgccgcac tggcggaagg        60
     tacgtcgagc cgggcggtga gttcacccgg gatcagcgct atatcgccac ccggatcacc       120
     gccgacggtg gggacggctg gccggtggag ccggggcggt accggctcgc ggtgagtcgc       180
     gcctgcccgt gggcgaaccg gctggtcatc gtccgacgac tactcgggct ggagggcgtc       240
     ctctccatgg cgatcgccgg tccgacccac gaccggcgaa gctggagttt cgacctcgac       300
     cccggcgggc gggatccggt gctcgacatc gaacggctgg cggaggccta cttcgcgcgc       360
     ttccccggct acgaccgcgg aatcacggtc cccgcgatca tcgacgtacc gaccgggcag       420
     gtggtgacca acgacttcgg gcagatgagt ctcgacctgt ccacccagtg gaccgcgtac       480
     caccgcgacg gggcaccgga gctctacccg cagcggctcc gggatgagat cgacgaagtg       540
     aacggggtcg tcttcgccga tgtcaacaac ggtgtctacc ggtgtggctt cgccggcagc       600
     cagtcggcgt acgaccgggc gtaccggcgg ctgttcgacc ggctggactg gctgagcgac       660
     cggctcgccg aacgccgcta cctggtcggg gagacaatca ccgaggcgga cgtacggctg       720
     ttcaccacgc tggtccgctt cgacccggtc taccacggcc acttcaagtg caaccgcagc       780
     aagttgaccg agatgccggt gctctgggcg tacgcccggg acctgttcca gacccccggg       840
     ttcggcgaca ccatcgactt cgaccacatc aagcggcact actacgaggt gcacggggac       900
     ctcaacccga ccgggatcgt cccgctcggc ccggacctgg cgaactggct gacaccgcac       960
     ggtcgggggg agctgggtgg tcgccccttc ggcgacggca ccgccccacc gccgccccca      1020
     ccagccgagc gggtcgaccc cgcgcacacc ccactgcgct ga                         1062
//

If you have problems or comments...

PBIL Back to PBIL home page