(data stored in ACNUC7421 zone)

EMBL: CP000667.PE409

CP000667.PE409       Location/Qualifiers
FT   CDS_pept        complement(470127..470621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0409"
FT                   /product="protein of unknown function DUF520"
FT                   /note="PFAM: protein of unknown function DUF520"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52894"
FT                   /db_xref="InterPro:IPR007551"
FT                   /db_xref="InterPro:IPR035570"
FT                   /db_xref="InterPro:IPR035571"
FT                   /db_xref="InterPro:IPR036183"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Z4"
FT                   /protein_id="ABP52894.1"
FT                   /translation="MAANPSFDIVSKVDRQEVDNALHQTERELSTRFDFRGTGAEISWS
FT                   GEEAISLRAETEERVKAALDVFKEKLVKRNISLKSLDAGDPRASGKEFKVDCKVIQGIE
FT                   SDKAKAISKKIRDEGPKGVQAQIQGDQLRVTGKKKDDLQAIIAMLKGEDFGVALQFTNY
FT                   R"
     atggcagcca acccgtcgtt cgacatcgtg agcaaggtcg accgtcagga ggtcgacaac        60
     gccctccacc agacggagcg ggagctctcg acgcggtttg acttccgggg caccggtgcc       120
     gaaatctcct ggtctggcga ggaggcgatc agccttcggg cggagaccga ggagcgggtc       180
     aaagccgcgc tggatgtctt caaggagaag ctggtcaagc ggaacatctc gctgaagtca       240
     ctggacgccg gagaccctcg cgcgtcgggt aaggaattca aggtcgactg caaggtgatc       300
     cagggcatcg agtcggacaa ggccaaggcc atcagtaaga agatccgcga cgagggcccg       360
     aagggcgtcc aggcgcagat ccagggtgac cagctccgcg tgaccggcaa gaagaaggac       420
     gacctgcaag ccatcatcgc catgctgaag ggcgaagact tcggcgtcgc actccagttc       480
     accaactacc gctag                                                        495
//

If you have problems or comments...

PBIL Back to PBIL home page