(data stored in ACNUC7421 zone)

EMBL: CP000667.PE41

CP000667.PE41        Location/Qualifiers
FT   CDS_pept        complement(47663..48736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0041"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility C-terminal
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52526"
FT                   /db_xref="GOA:A4X0X6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0X6"
FT                   /protein_id="ABP52526.1"
FT                   /translation="MSVAFVTGSGGLIGSEAVRHFAGLGLEVVGIDNDMRQEFFGEEAS
FT                   TAWNVRGLTEELGAAYSHHSIDIRDRDALAKLFRRYGRNTAVVIHTAAQPSHDWAVRDP
FT                   FTDFDVNAAGTLNVLQNVREHCIEAPVIHCSTNKVYGNRPNSLPLVELETRWEIEPGHP
FT                   YEQGIREDMSIDACLHSIFGASKVAADVMVQEYGRYFDMRTACFRGGTLTGPAHAATEL
FT                   HGFLGYVMRANMERRKYKIFGYQGKQVRDAIHSSDVVSAFESFFRNPRSAAVYNLGGGR
FT                   HSNTSMREAFALAQQITGQEMNSEYVEANRIGDHKWWIGSNEAFHADYPDWKQVYDVPM
FT                   IMREIYEANVDKWIPQP"
     gtgagtgtcg cattcgtgac cggatcgggc ggtctgattg gctccgaagc ggttcgacat        60
     tttgccggcc tcggactcga ggtcgtcggt atcgacaacg acatgcggca ggagttcttc       120
     ggcgaggagg cctcgaccgc ctggaacgtc cgggggctga ccgaggaact gggcgccgcc       180
     tactcgcacc acagcattga catccgcgac cgggacgcgc tcgcgaagct cttccgccga       240
     tacggccgca acaccgctgt ggtgatccac accgccgcac agccgtcgca cgactgggcc       300
     gtccgcgacc cgttcaccga cttcgacgtc aacgcggccg gcaccctcaa cgtgctacag       360
     aacgtccgcg agcactgcat cgaggcgccg gtcatccact gctccaccaa caaggtctac       420
     ggaaaccggc cgaacagcct gcccctggtc gagttggaga cccggtggga gatcgagccc       480
     gggcacccgt acgagcaggg catccgggaa gacatgtcga tcgacgcctg cctgcactcg       540
     atcttcggcg cctccaaggt ggcggcggac gtgatggtgc aggagtacgg ccgttacttc       600
     gacatgcgga cggcctgctt ccggggtgga accctgaccg ggcccgcgca cgccgccacc       660
     gagttgcacg gcttcctcgg gtacgtgatg cgggccaaca tggaacgccg gaaatacaag       720
     atcttcggat atcagggcaa gcaggtccgg gacgcgatcc acagctcgga cgtggtctcg       780
     gcgttcgagt cgttcttccg taacccgcgc tccgccgccg tctacaacct gggcggtggc       840
     cggcactcca acacctcgat gcgcgaggcc ttcgccctgg cccagcagat caccggacag       900
     gagatgaact ccgagtacgt cgaggcgaac cgaatcggcg accacaagtg gtggatcggc       960
     tcgaacgaag ccttccacgc ggactacccg gactggaagc aggtctacga cgtgcccatg      1020
     atcatgcgtg agatctacga ggccaacgtc gacaagtgga ttccgcagcc atga            1074
//

If you have problems or comments...

PBIL Back to PBIL home page