(data stored in ACNUC7421 zone)

EMBL: CP000667.PE414

CP000667.PE414       Location/Qualifiers
FT   CDS_pept        474965..475804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0414"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52899"
FT                   /db_xref="InterPro:IPR021391"
FT                   /db_xref="UniProtKB/TrEMBL:A4X1Z9"
FT                   /protein_id="ABP52899.1"
FT                   /translation="MGNNGRVTRSASARAPRLDQVCAAAVEVARDAITEVDPADVGDHL
FT                   QTLAEGDRLVTHYFECRLAGYRGWRWAVTVTRVPRSRTVTVCETVLLPGPDALLAPGWL
FT                   PWQERLQPGDLGPGDLLPSPPDDDRLQPGYLLSDDPAVEEVAWELGLGRVRVMSREGRG
FT                   EAAQRWYDGDHGPTAPIATAAPMTARCGSCGFYLPLAGTLCQSFGACGNLYAPDDGRVV
FT                   SADHGCGAHSEILVETPEAPVEELPTVYDDSAVEAVPVRGADASAEVAEVAGSHGES"
     atggggaaca atggtcgggt gaccaggtcc gcctccgctc gtgccccccg tctcgaccag        60
     gtctgtgccg ccgccgtcga ggtggctcgc gacgccatca ccgaggtcga cccggcggat       120
     gtcggcgatc atctccagac cctcgccgaa ggtgatcgcc tcgtcaccca ctacttcgag       180
     tgtcggctcg cgggttatcg cggctggcgc tgggctgtca ccgtcacccg ggtacctcgc       240
     agccgtacgg tcaccgtgtg tgagactgtg ctgctgcccg gcccggatgc gctactcgcc       300
     ccgggctggc tgccctggca ggagcggcta cagcccggtg acctcggccc gggtgacctg       360
     ctgcccagcc cgcccgacga cgaccggctc cagcccggtt acctgctctc cgacgacccg       420
     gcggtcgagg aggtcgcctg ggaactgggt ctcggccggg tgcgggtgat gtcccgggag       480
     gggcgcggcg aagccgccca acggtggtac gacggcgacc acgggccgac cgcaccgatc       540
     gccaccgccg ctccgatgac tgcccgctgc gggagctgcg gtttctatct gccgctcgcc       600
     gggacgctgt gccagtcctt cggcgcctgt ggcaacctct acgccccgga tgacggccgc       660
     gtggtcagcg ccgaccacgg ctgcggtgcg cattcggaga tcttggtcga gacccccgag       720
     gccccggtcg aggagctacc caccgtctac gacgacagcg cggtggaggc cgtcccggtg       780
     cgcggggccg acgcgtcggc cgaggtcgcc gaggtggcag ggtcgcatgg cgaatcgtga       840
//

If you have problems or comments...

PBIL Back to PBIL home page