(data stored in ACNUC7421 zone)

EMBL: CP000667.PE415

CP000667.PE415       Location/Qualifiers
FT   CDS_pept        complement(475823..476068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0415"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52900"
FT                   /db_xref="GOA:A4X200"
FT                   /db_xref="InterPro:IPR019681"
FT                   /db_xref="UniProtKB/TrEMBL:A4X200"
FT                   /protein_id="ABP52900.1"
FT                   /translation="MLKQPQPRPEPLDPPMVPFALAGMVGWAIAGVVLLFFRDQLVETG
FT                   REGWLWTCLAGFLWGLPGLAVMMRHDTHRRRRRAGH"
     gtgctgaagc agccacaacc gcggcccgaa ccgctcgacc cgccgatggt gccgttcgcc        60
     ctcgccggga tggtcggctg ggcgatcgcc ggagtcgtgc tgctgttctt ccgcgaccag       120
     ctggtggaaa ccggccgcga gggctggctc tggacctgcc tggctggctt cctgtggggt       180
     ctgcccggtc tcgccgtaat gatgcggcac gacacgcacc gacgtcgccg ccgcgccggt       240
     cactga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page