(data stored in ACNUC7421 zone)

EMBL: CP000667.PE421

CP000667.PE421       Location/Qualifiers
FT   CDS_pept        complement(480740..481804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52906"
FT                   /db_xref="InterPro:IPR021421"
FT                   /db_xref="UniProtKB/TrEMBL:A4X206"
FT                   /protein_id="ABP52906.1"
FT                   /translation="MRPVRFVALSEDGQALVLTDEVGRLLALPIDERVSTALHTEPGAA
FT                   PLAVASTPGTDPAPSLAPRDIQARIRAGESAEDVARIAGVPVDRVLRYAGPVLQERAML
FT                   AHHARRTRLRGAEKPTPLAEVVNGRLSQHGIDTEKISWDAWRRDDGTWRIVATWPSGKA
FT                   TAQAVWDLEKSRQSVTPHDDMAQYLCAERPMPILGQEPTSERGGHGLPGPPRAEPGRGG
FT                   HGLPGPTEPTRPVRDPIRAGRDALLASLDRPLGGASGRGLEPRGPETPRPRTVGGGAAA
FT                   LLGGGPGSAFDDDSDAPKEVPAVPSLAVLRPRRTGAATAGSTEPGESGNKPRKRLPSWD
FT                   DVLFGGAPAARESS"
     atgcgcccag tacgctttgt cgccctctcc gaggacggcc aggcactggt tctgaccgac        60
     gaggttgggc gacttctcgc gctccccatt gacgagcgcg tctccaccgc cctgcacacc       120
     gagcccgggg ccgcacccct ggcggtggcc tcgacgccgg gcaccgaccc ggccccatcc       180
     ctggccccac gggatatcca ggcccggatt cgggccggtg agtccgccga ggatgtcgcc       240
     cggatcgccg gcgtccccgt tgaccgggtg ctgcgctacg ccggcccggt cctccaggag       300
     cgagccatgc tcgcccacca cgcccgtcgt acccgcctgc ggggggccga gaagccaacc       360
     ccgctcgccg aggtggtcaa cggtcggttg tcccagcacg gcatcgacac cgagaagatc       420
     tcgtgggatg cgtggcgtcg cgacgacggc acctggcgga tcgtcgccac ctggccctcc       480
     ggcaaggcca ccgcccaggc ggtgtgggat ctggagaagt cccggcagtc ggtcacgccg       540
     catgacgaca tggcccagta cctctgcgcc gagcgtccca tgccgatcct cgggcaggag       600
     ccgacgtccg agcggggtgg ccatgggctg cccggcccac cgcgggccga gcccggccgc       660
     ggtgggcacg gcctgccggg tccgaccgag cccacccggc cggtccgcga tccgatccgc       720
     gccggtcggg acgccctgct cgcctccctg gaccgcccgc tcggcggcgc gtccggccgt       780
     ggcctcgagc cccggggccc ggagacgccg cgcccacgaa cagtcggtgg cggcgcggcg       840
     gcgctactcg gtggcggccc ggggtcggcc ttcgacgacg actcggacgc accgaaggag       900
     gtgccggctg tcccgtcgct ggccgtgctc cggccacgcc gcacgggtgc cgcgacggcg       960
     ggcagcaccg agccgggcga gagcggcaac aaaccgcgca agcggctacc gagctgggac      1020
     gacgtgctct tcggcggcgc cccggcagcc cgcgagtcct cctga                      1065
//

If you have problems or comments...

PBIL Back to PBIL home page