(data stored in ACNUC7421 zone)

EMBL: CP000667.PE43

CP000667.PE43        Location/Qualifiers
FT   CDS_pept        49945..50430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0043"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52528"
FT                   /db_xref="GOA:A4X0X8"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0X8"
FT                   /protein_id="ABP52528.1"
FT                   /translation="MPELVITVARFGFLILLWIFVFTVVGVIRRDLFAGARSGRLVAAP
FT                   RGVGAVLGQGGKPARAKRGRAAHQLVVTAGQLAGTRITLGEAQITIGRAEDSTLVITDD
FT                   YASARHARLVPRDGQWFVEDLGSTNGTYLDRAKVTGPTPVPLGVPIRIGRTSLELRP"
     ttgccggaac tcgtcatcac cgttgcccgg ttcgggttcc tgatcctgtt gtggattttt        60
     gtcttcacgg tggtcggggt gattcgccgg gacctcttcg caggtgcccg ctctggtcgg       120
     ctggtggcgg ccccccgggg ggtcggggcc gtcctcggtc agggcggaaa gccggcccgg       180
     gcaaagcggg gaagggcagc ccaccagctg gtggtgaccg ccggccagct ggccggcacc       240
     cgtatcacac tcggtgaagc gcagatcacc atcggccggg ccgaggattc caccctcgtg       300
     atcaccgatg actacgcctc cgcacgacac gcccggctcg tgccccgcga cgggcagtgg       360
     ttcgtcgagg acctcggttc gactaacggc acctacctgg atcgcgctaa ggtcaccgga       420
     cctacccccg tccccctcgg cgtgccgatc cgcatcgggc gcacctcact cgaattacgg       480
     ccatga                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page