(data stored in ACNUC7421 zone)

EMBL: CP000667.PE436

CP000667.PE436       Location/Qualifiers
FT   CDS_pept        498862..499293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0436"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52921"
FT                   /db_xref="InterPro:IPR027961"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4X221"
FT                   /protein_id="ABP52921.1"
FT                   /translation="MLAAVPFARTLGFEFVKVAPEADGAIQAVVRLPDTSATHNHVGGP
FT                   HAGAMFTLGETASGAVVVAAFAPVLDRATPLAVSAEIAYRKLAMGPVRATARLDRPAAD
FT                   VVAELDAGERPEFPVRVEIATEEGKPTGEMTVVWTLRPH"
     atgctggcag ccgtgccctt cgcccgcacg ctgggcttcg agttcgtcaa ggtggccccc        60
     gaggccgacg gcgcgatcca ggctgtggtc cggctgcccg acacatcggc tacgcacaac       120
     catgtcggcg ggccgcacgc cggagccatg ttcaccctcg gtgagaccgc ctctggtgcg       180
     gttgtggtgg ccgcgttcgc gccggtgctt gaccgggcga ccccgctcgc cgtcagtgcc       240
     gagatcgcgt accggaagct cgccatgggc ccggtgcggg cgaccgcgcg gctcgatcgt       300
     ccggccgctg acgtggtcgc ggaactggac gccggagagc gtcccgagtt tccggtacgc       360
     gtggagatcg ccactgagga gggcaagccc accggggaga tgaccgtcgt ctggacgctt       420
     cgcccgcact ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page