(data stored in ACNUC7421 zone)

EMBL: CP000667.PE437

CP000667.PE437       Location/Qualifiers
FT   CDS_pept        499373..500107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0437"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; beta-phosphoglucomutase family hydrolase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52922"
FT                   /db_xref="GOA:A4X222"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A4X222"
FT                   /protein_id="ABP52922.1"
FT                   /translation="MTACLFDLDGVLTQTARVHNAAWRATFDEFLRRHAADADVPFQPF
FT                   DPDEDYRRYVDGRPRYDGVRTFLASRDIVLPEGTPDDPPEADTVHGIGNCKNVRLLQEL
FT                   RTHGVDVYPGSVTYLKAATDAGLRRAVVTASANGREVVAAAGLEALLETRVDGLVARAE
FT                   KLRGKPEPDTFLAGAERLGVAPGNAAVFEDALAGVAAGRAGDFGYVVGVDRAGQADALL
FT                   AHGADIVVQDLAELIEKREPDA"
     gtgaccgcct gcctgttcga cctggacggg gtcctcaccc agaccgctcg cgtccacaac        60
     gccgcgtggc gtgcgacgtt cgacgagttc ctgcgtcgtc acgccgccga cgccgatgtg       120
     ccgttccaac cgttcgaccc ggatgaggac taccgtcggt atgtcgacgg ccggccccgg       180
     tacgacgggg tccgcacctt cctcgcctcg cgcgacatcg tgcttccgga gggaacaccg       240
     gacgacccgc ccgaggcgga cacggtccac ggcatcggca actgcaagaa cgtccggctg       300
     ctccaggagc tgcggacgca tggggtggat gtctaccctg gctcggtgac gtacctcaag       360
     gcggcgaccg acgccgggct gcgtcgtgcg gtcgtcaccg ccagcgccaa cggccgtgag       420
     gtggtcgccg cagcagggct ggaggcgctg ctggagaccc gggttgatgg tctcgtcgcc       480
     cgagccgaga agctacgcgg caaaccagaa ccggacacct tcctggccgg ggccgaacgg       540
     ctcggggtgg ctccgggcaa cgcggccgtc ttcgaggacg ccctcgccgg agtcgccgcc       600
     ggccgagccg gtgacttcgg gtacgtggtg ggcgtggacc gggccgggca ggccgatgcc       660
     ctgttggcgc acggcgcaga cattgtcgta caggatctcg cggagctgat cgagaagcgg       720
     gagccggacg catga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page