(data stored in ACNUC7421 zone)

EMBL: CP000667.PE438

CP000667.PE438       Location/Qualifiers
FT   CDS_pept        500104..502479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0438"
FT                   /product="Kojibiose phosphorylase"
FT                   /EC_number="2.4.1.230"
FT                   /note="PFAM: glycoside hydrolase, family 65 domain protein;
FT                   glycoside hydrolase family 65, central catalytic; glycoside
FT                   hydrolase family 65 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52923"
FT                   /db_xref="GOA:A4X223"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:A4X223"
FT                   /protein_id="ABP52923.1"
FT                   /translation="MIRERAYPVEPWHVRETTLDMDVLAQSESVFALSNGHIGLRGNLD
FT                   EGEPYGLPGTYLNSFYELRPLPHAEAGFGFPESGQTIVNVTNGKLIRLLVDDEPLDVRY
FT                   GELLAHERVLDLRGGTLHRTVHWRSPAGREVCVRSTRLVSFRQRSAAAINYEVEVVDGK
FT                   PLRLIVQSELVANETLPAQSKDPRVAAVLESPLLAEEELTTHDGGLLIHRTKVSGLRLA
FT                   AAMEHEVHTTARTNLESEGYEDWVRTTTACVLKPGETLRVVKYLSYGWSSRRSLPALRD
FT                   QVGAALAAAKLDGWDGLLREQREYLDEFWDSADVLVEGDPEVQQAVRFGLFHVLQAGTR
FT                   AERRPISAKGLTGPGYDGHAFWDTEMFVLPVLTYTHPTAVRDALYWRHHTLPAAQDRAR
FT                   TLNLAGAAFPWRTIEGPESSGYWPAGTAGFHIAADIADAVRRYVHATQDTDLEREIGLE
FT                   LLVETARLWRSLGHHDRHGQFHIDGVTGPDEYTAIKNDNIYTNLMAQRNLTTAAETVMR
FT                   YRDEAAHLGVTDEEAASWRDAAADIHIPYDQEIDVHEQVEGFTRFQEWDFVHTPPEKYP
FT                   LLLHYPYFDLYRKQVIKQADLVLAMHWRGDAFTPEQKLRNFLYYERRTVRDSSLSACTQ
FT                   AVLAAEVGYSELAHTYLREAALMDLHDLNENTRDGVHIAALAGSWIALVAGFGGLRDHD
FT                   GTLCFTPRLSSRLGRLEFSLHWRRIQLRVDIQPHQTTYTLQHSDPEEALEFLHHGERIR
FT                   VTAAEPVTRPTPPAEEPSRAPEQPPGRDPLIRLPEREP"
     atgatccgag agcgcgcgta cccggtcgag ccgtggcatg tccgagaaac cacgctggac        60
     atggatgtgt tggctcagtc cgagtcggtc ttcgccctct ccaacgggca catcggcctg       120
     cgcggcaacc tcgacgaagg cgagccgtac ggcctgcccg gaacgtacct gaactccttc       180
     tacgagcttc gccccctgcc gcacgcggag gccggcttcg ggtttcccga gtccgggcag       240
     accatcgtca acgtcaccaa cggcaagctc atccggctcc tggtcgacga cgagccgctc       300
     gatgtgcgat acggcgaact cctcgcccac gagcgggtgc tcgacctgcg aggcggcacg       360
     ctgcaccgga ccgtgcactg gcgctcgccg gccggtcggg aggtctgcgt ccgcagcacc       420
     cggttggtct cgttccgcca gcgctccgcc gccgccatca actatgaggt cgaggtcgtg       480
     gacggcaagc cgctgcggct gatcgtccag tcggaactgg tggccaacga aaccctgccg       540
     gcccagagta aagatccgcg ggtggcggcg gtgctggagt cgcccctgtt ggccgaggag       600
     gagctgacca cccatgacgg tggtctgttg atccaccgca cgaaggtctc cggcctgcgc       660
     ctcgccgccg cgatggagca cgaggtgcac accaccgcac ggaccaacct cgagtccgag       720
     gggtacgagg actgggtgcg gaccaccacc gcctgcgtgc tcaagcccgg cgagacgctg       780
     cgggtcgtga aatacctgtc gtacgggtgg tccagccgcc gatcgttgcc ggcactgcgg       840
     gatcaggtcg gtgccgcgct ggccgccgcg aagctggacg ggtgggacgg gctgctgcgg       900
     gaacagcggg agtacctgga cgagttttgg gactccgccg acgtgctggt ggagggcgac       960
     cccgaggtgc agcaggcggt acgcttcggg ctctttcacg tgctccaggc gggcacccgg      1020
     gccgaacgcc ggccgatctc ggcgaagggc ctcaccggtc cggggtacga cggccatgcc      1080
     ttctgggaca ccgagatgtt tgtgctgccg gtgctgacct acacccaccc caccgcggtc      1140
     cgcgacgccc tgtactggcg gcatcacacc ctgccggcag cgcaggaccg ggcccgcacg      1200
     ctcaacctgg cgggcgcggc cttcccctgg cgcaccatcg aggggccgga atcctccggc      1260
     tactggccag ccggcaccgc cggctttcac atcgccgccg acatcgccga cgcggtacgt      1320
     cgctacgtgc acgccaccca ggacaccgac ctggagcggg agatcggcct ggagttgctg      1380
     gtggagaccg cgcggttgtg gcggtcgctg ggccaccacg accggcacgg gcagttccac      1440
     attgacgggg tgaccggccc ggacgagtac accgctatca agaacgacaa catctacacc      1500
     aatctgatgg cgcaacggaa tctgaccacc gccgcggaga cggtgatgcg gtaccgggac      1560
     gaggccgcgc atctgggtgt caccgacgag gaggcggcgt cgtggcggga cgccgccgcc      1620
     gacatccata tcccatacga ccaggagatc gacgtacacg agcaggtcga gggcttcacc      1680
     cggttccagg agtgggactt cgtccacacc ccgccggaga agtacccgtt gctgctgcac      1740
     tatccctact ttgatctgta ccgcaagcag gtgatcaaac aggctgatct ggtgctggcg      1800
     atgcactggc ggggggacgc gttcaccccg gagcagaagc tgcgcaactt tctctactac      1860
     gagcgccgta ccgtccgcga ctcgtcgttg tcggcctgta cccaggccgt gctggctgcc      1920
     gaggtggggt attcggaact agcccacacc tatctgcgcg aggccgcgtt gatggacctg      1980
     cacgacctga acgagaacac ccgcgacggg gtccacatcg ccgccctggc cggttcctgg      2040
     atcgccctgg tcgccgggtt cggcgggttg cgcgaccacg acggaacgct ctgcttcacg      2100
     cctcggctct ccagccggct gggccggttg gagttctccc tacactggcg tcggatccag      2160
     ctacgggtcg acatccagcc gcaccagacc acctacacgt tgcagcacag cgaccccgag      2220
     gaggcgctgg agttcctcca ccacggcgaa cgcatccggg tcaccgcggc tgaaccggtg      2280
     acccggccaa ccccaccagc ggaggagccg agccgggccc cggagcagcc gcccggccgt      2340
     gacccgctca tccgcctccc cgagcgggaa ccgtag                                2376
//

If you have problems or comments...

PBIL Back to PBIL home page