(data stored in ACNUC7421 zone)

EMBL: CP000667.PE44

CP000667.PE44        Location/Qualifiers
FT   CDS_pept        50427..51875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0044"
FT                   /product="protein phosphatase 2C domain protein"
FT                   /note="PFAM: protein phosphatase 2C domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52529"
FT                   /db_xref="GOA:A4X0X9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0X9"
FT                   /protein_id="ABP52529.1"
FT                   /translation="MTLTLRYAAHSDRGLIRDGNQDSVYAGPRLLAVADGMGGMAAGDV
FT                   ASNIVIGAMAPLDEDVPGNALVDALRSAVTNATQQLRETVDANPQLEGMGTTLTAILFS
FT                   GSKLGMVHIGDSRAYLLRASEFAQITKDDTYVQMLVDEGRISAEEASSHPQRSLLTRAL
FT                   DGRDIDAEYSVRQVLTGDRYLICSDGLSGVVSAETIAETMREYADPQQCVERLVQLALR
FT                   GGGPDNITVIIADATDQDIVEATPIVGGAASRDRGMATSADDSTPAARASALSGSPPVT
FT                   PDESTAAADEEPERRRRRPIRLVATSLALIVLLGGALYGGWSYTQRQYYVGATGGGQVA
FT                   VFRGIEGEIAGIDLSAVHSTSSAELDDLTLAAQERVKQGIPAESEADAERRLAELTADT
FT                   PTNPNLKPTCPPSPSPSPSPPVVPSPTAEPGAPTPTTEPSAPPSISATSSTPATGLPTE
FT                   PTLSPDALPAIPPAVDPAACRSPE"
     atgactctga ccctccgcta tgcggcccac agcgaccgcg ggctgatccg agacggtaac        60
     caggactccg tctatgccgg gccacggctg ctcgccgtcg ccgacggcat gggcggtatg       120
     gccgccggtg acgtcgccag caacatcgtc atcggcgcca tggcaccgct ggacgaggac       180
     gtcccgggca acgccctcgt ggatgcgctt cgttcggctg tcaccaacgc cactcaacag       240
     ctacgcgaga cggttgacgc caacccgcag ctggagggga tggggacgac gctcaccgcg       300
     atcctcttct ctggcagcaa gctgggcatg gtgcacatcg gcgactcccg tgcctacctg       360
     ctgcgcgcca gcgagttcgc ccagataacc aaggacgaca cgtacgtcca gatgcttgtt       420
     gacgagggcc ggatcagcgc cgaggaggcg agtagccacc cccagcggtc gctgctgacc       480
     cgggctctcg acggccggga catcgacgcg gagtactcgg tccgccaggt cctcaccggc       540
     gatcgatacc tgatctgtag cgacggtctc tcgggcgtgg tgagcgcgga gacgatcgcg       600
     gagacgatgc gggagtacgc cgacccacaa cagtgcgtgg agcggctggt ccagctcgca       660
     ctgcggggtg gcggaccgga caacatcacc gtgatcatcg ccgacgcgac ggaccaggac       720
     atcgtcgaag cgaccccgat cgtcggtggc gccgcctccc gggaccgggg tatggcgacc       780
     tccgccgacg actccacccc tgcggcccgc gcctcggcgc tctccggatc gccaccggtg       840
     acgccggacg agtcgactgc cgcagccgac gaggagccgg agcgccgtcg ccgtcggccg       900
     atccgtctcg tggcgacgag cctcgcgctg atcgtccttc tgggcggagc gctctacggt       960
     gggtggagct acacccagcg gcagtactac gtcggagcta cggggggcgg ccaggtcgcg      1020
     gtgttccgtg gcatcgaagg tgagatcgcc ggcattgacc tctccgccgt gcactcgacc      1080
     agctccgccg agctggacga cctcacgctt gccgcgcagg agcgggtcaa acagggcatc      1140
     ccggccgaaa gtgaagcgga tgcggagcgc cggctggccg agctgaccgc cgacaccccg      1200
     accaacccca acctgaagcc gacctgtccc cccagcccca gcccgagccc gagcccgcca      1260
     gtggtgccga gcccgacagc ggagcccgga gcgccgacgc cgaccaccga gccgagtgcg      1320
     cctccgtcga tctccgccac atcgagcaca ccggcgaccg gcctgccgac cgaaccgacc      1380
     ctctcgcccg acgccttgcc cgccatcccg ccggccgttg atccggccgc ctgccggtcg      1440
     cccgagtga                                                              1449
//

If you have problems or comments...

PBIL Back to PBIL home page