(data stored in ACNUC7421 zone)

EMBL: CP000667.PE440

CP000667.PE440       Location/Qualifiers
FT   CDS_pept        503707..503895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52925"
FT                   /db_xref="InterPro:IPR028037"
FT                   /db_xref="UniProtKB/TrEMBL:A4X225"
FT                   /protein_id="ABP52925.1"
FT                   /translation="MKKFMDQAREYVEKQDEQVDRSIEKAGDMLNERTGGRYKEHVDRG
FT                   VDMMRSRTGESDRDQKR"
     atgaagaaat tcatggacca ggccagggag tacgtcgaga agcaggacga gcaggtcgac        60
     cggagcatag aaaaggccgg tgacatgctc aacgagcgca ccggcggccg gtacaaggag       120
     catgtcgatc gcggcgtgga catgatgcgg tctcggacgg gtgagagcga ccgcgaccag       180
     aagcgctga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page