(data stored in ACNUC7421 zone)

EMBL: CP000667.PE444

CP000667.PE444       Location/Qualifiers
FT   CDS_pept        complement(507057..508403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0444"
FT                   /product="YibE/F family protein"
FT                   /note="PFAM: YibE/F family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52929"
FT                   /db_xref="GOA:A4X229"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:A4X229"
FT                   /protein_id="ABP52929.1"
FT                   /translation="MGADHTRPAPSAPPRVRRLLVATVVPLLLATLITAVALWPRDTST
FT                   ADPGTEPPRYHGTVTKVVTEPCPPTPETPDPGLATDDGPCGDVTVRVEQGPDSGRQVVT
FT                   PLPAGPGAPDVAIGDEIILVELTDPTDPTTSMYTIAEHQRGKPLLWLVALFAAAIVAFG
FT                   RWRGLAALAGLAASFAVLLTFVLPGISVGRSPLLVAVVGAALIMFVVLYLTHGVTVQTS
FT                   VAVLGTLGSLILTGLLGTLATATTRLTGYGSEEAITLSMFQADVDLHGLLLAGIIIGSL
FT                   GVLDDVTVTQAATVTELANANPGLSRRQLYRSATRVGRAHIASTVNTIVLAYAGASLPV
FT                   LLLLTADSRPVSQILTSEFLAQEIVRSAVATLGLIAAVPLTTGLAAIVTTAGRNAVGGS
FT                   GRSATAAPPPRPRAARVEVLEALSTSRAGPVTPVADRRADRDKNTDDPW"
     atgggcgccg accacacccg acccgctccg tccgccccac cccgggtgcg acggctcctc        60
     gtcgcgacgg tggtccccct gctcctcgcc accctgatca ccgcggtggc cctctggccg       120
     cgcgacacca gtacggccga tccgggcacc gagccgcccc ggtaccacgg caccgtgacg       180
     aaggtggtca ccgaaccctg tccccccacg ccggagacac ccgatccagg actggccacc       240
     gacgacggcc cctgtggcga cgtgaccgtc cgcgtcgagc aggggccgga ctccgggcgt       300
     caggtcgtca cgccgttacc cgccggacca ggcgcccccg acgtcgccat cggtgacgag       360
     atcatcctgg tcgagctgac cgaccccacc gacccgacca cgagcatgta caccatcgcg       420
     gagcaccagc ggggcaagcc cctgctgtgg ctggtggcgc tcttcgccgc cgcgatcgtg       480
     gcgttcggcc gctggcgcgg gctcgccgcg ctcgccggcc tggcggcgag cttcgccgtc       540
     ctgctgacat tcgtcctgcc agggatcagc gtcggccgct ctccgctact ggtcgcggtg       600
     gtcggcgccg ccctgatcat gtttgtggtc ctgtacctca cccacggcgt gaccgtgcag       660
     acatcggtgg cggttctcgg caccctgggc agcctgatcc tcaccggcct cctcggcaca       720
     ctcgccaccg ccaccacccg gctgaccggg tacggcagcg aggaggcgat cacgctgtcg       780
     atgttccagg ccgacgtcga cctgcacggt ctgctgctgg ccggaatcat catcggctcg       840
     ctcggcgtcc tggacgatgt caccgtgacc caggccgcca cggtgaccga actggcgaac       900
     gccaacccgg ggctgtcccg ccgccagctc taccgctccg ccacccgggt cggtcgggcc       960
     cacatcgcct ccacggtgaa caccatcgtg ctggcgtacg ccggagcctc gctaccggtg      1020
     ctgctcctac tcaccgccga ctcgcgaccg gtgagccaga tcctgaccag cgaattcctc      1080
     gcccaggaga tcgttcgcag cgccgtggcc acgctgggtt tgatcgccgc ggtccccctc      1140
     accaccgggc tcgccgccat cgtgaccacc gccggtcgca acgctgtcgg cgggtcgggg      1200
     aggagcgcca ccgccgcgcc accgccgcga ccgcgcgccg cccgggtcga ggtgctggag      1260
     gcgctcagca cctcccgcgc cggcccggtc acccccgtcg ccgaccgacg tgccgaccgg      1320
     gacaagaaca cggacgaccc atggtga                                          1347
//

If you have problems or comments...

PBIL Back to PBIL home page