(data stored in ACNUC7421 zone)

EMBL: CP000667.PE445

CP000667.PE445       Location/Qualifiers
FT   CDS_pept        complement(508593..508904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0445"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52930"
FT                   /db_xref="GOA:A4X230"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:A4X230"
FT                   /protein_id="ABP52930.1"
FT                   /translation="MVRMTRPEPAPVRGYTATKDQLLTRLRRVEGQVRGIEKMVEEDRY
FT                   CIDVLTQIAAIQAALDKVALGLLDGHARHCMREGAAEGRADEMATEMMAAVGRLMKRG"
     atggtccgca tgaccagacc cgaacccgct ccggtccgcg gctacaccgc caccaaggac        60
     cagctgctca cccggctgcg ccgggtcgag gggcaggtcc gggggatcga gaagatggtc       120
     gaggaggatc ggtactgcat cgacgtcctc acccagatcg ccgcgatcca ggccgcgctg       180
     gacaaggtgg cgctcgggct actcgacggg cacgcccgac actgcatgcg cgagggggcc       240
     gccgaggggc gagccgacga gatggcgacc gagatgatgg ccgccgtcgg ccgactgatg       300
     aagcgcggct ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page