(data stored in ACNUC7421 zone)

EMBL: CP000667.PE45

CP000667.PE45        Location/Qualifiers
FT   CDS_pept        51904..53394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0045"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52530"
FT                   /db_xref="GOA:A4X0Y0"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y0"
FT                   /protein_id="ABP52530.1"
FT                   /translation="MTVAATSTSPPTNTGGQSGVRLARSRRNAELSLLLLAMVLVAAYG
FT                   AMVEASVLDTVTPSFWIPAAALTAVFLGLHVAIRFLAPFADPALLPAVALLNGLGVGFL
FT                   HRLDLARATPAERAELATFAGTGGRQLAWTLISVALAAGLLAIVRDHRSISRYAYTLGL
FT                   AGIVLVMIPAVLPRSISEINGAKLWIRVGGLSIQPGEFAKLALLAFFAYYLVRKREVLS
FT                   LASRRILGVDLPRGRDLGPVVVVWLISLLVLVFEKDLGTSLLYFGMFVATLYIATERVS
FT                   WLLIGLVLFFGGAYLAYVLGDAIGGPFANFYLRANIWLDPFADPYNDGYQLVQGLLALG
FT                   SGGMFGAGPGAGQPLKLPEVQNDFIFAGLGEEIGLFGLSALLVVYLLIVERGLRAALAV
FT                   HDSFGKLLAGGLAFTLGLQVFVIVGGISGLIPLTGQTTPFLSAGGSSLMANWLLIAILL
FT                   RVSDAARRPVTSGGPPSPRSTGGPPEQLHGAPTEVIRP"
     gtgaccgtag cggccacgtc gacttccccg cccaccaaca cgggcgggca gagcggcgtg        60
     cggctggccc ggtcccggcg caacgccgag ctgtcgctgc tgctgctcgc catggtgctg       120
     gtggccgcgt acggggcgat ggtcgaagcc agtgtgctgg acacggttac gccgagcttc       180
     tggataccgg ccgccgcgct caccgcggtc ttcctcggcc tgcacgtggc gatccggttc       240
     ctggccccct tcgccgaccc ggccctgtta ccggcggtcg cccttctcaa cggcctcggg       300
     gtcggctttc tgcaccggct ggacctggcc cgcgccaccc cggccgagcg cgccgaactg       360
     gcgaccttcg ccggcaccgg cgggcgtcaa ctcgcctgga cactgatctc ggtcgccctc       420
     gctgccgggt tgcttgccat agtccgcgac caccgctcga tctcccggta cgcgtacacc       480
     ctgggtctcg ccggcatcgt gctggtgatg atcccggcgg tgctaccacg gagcatttcc       540
     gagatcaacg gcgcgaaact ctggattcgg gtcggcggtc tctccatcca gcccggcgag       600
     ttcgccaaac tcgcgctgct cgccttcttc gcgtactacc tggtccgcaa gcgggaggtt       660
     ctctccctgg ccagccgccg gattctcggt gtcgacctcc cgcggggccg ggacctcggg       720
     ccggtcgtgg tggtctggct gatcagcctc ctggtcctgg tcttcgagaa ggacctgggc       780
     acctccctgc tctacttcgg catgttcgtg gcaacgctct acatcgccac cgaacgggtg       840
     agctggcttc tcatcggtct ggtgctcttc ttcggtggcg cctatctcgc gtacgtgctg       900
     ggcgacgcga tcggcggccc gttcgccaac ttctacctgc gggccaacat ctggctggac       960
     ccgttcgccg acccgtacaa cgacggttac caactggtgc aggggctgct tgcccttggt      1020
     agcggtggaa tgttcggcgc cgggcccggc gccggccagc cactcaagct gcccgaggtg      1080
     cagaacgact tcatcttcgc cggcctcggc gaggagatcg gtctctttgg tctctccgcc      1140
     ctgctggtgg tctacctgct catcgtcgag cgggggctgc gtgccgcgct ggcggttcac      1200
     gactcgtttg gcaaactgct cgccggtggc ctggcgttca ccctcgggct ccaggtcttc      1260
     gtgatcgttg gcgggatcag cgggctgatt ccgcttaccg gccagaccac gccgttcctt      1320
     tccgccggtg gttcgtcgct gatggcgaac tggttgctca tcgcgatcct gctccgcgtc      1380
     tccgatgccg cccgtcggcc ggtgaccagc gggggccctc cgtcgccccg atcgacgggt      1440
     ggaccgccag agcagctaca cggtgccccc acggaggtga tcagaccgtg a               1491
//

If you have problems or comments...

PBIL Back to PBIL home page