(data stored in ACNUC7421 zone)

EMBL: CP000667.PE451

CP000667.PE451       Location/Qualifiers
FT   CDS_pept        complement(514356..515057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0451"
FT                   /product="Spermidine synthase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52936"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4X236"
FT                   /protein_id="ABP52936.1"
FT                   /translation="MHDFRQPPITLDRVTTSRGELVLRETNGRYEVISNGVFLMDTADG
FT                   RSERLLVDAAVSRCTGPAPRLLIGGLGVGFSLLRAVEHPHVAAIDVVEIEATVIGWHAR
FT                   HLRPLTGAAQADPRVRIVEADILAWLADTADQYDAICLDTDNGPNWLVFEANAELYAHR
FT                   GLDLVAGRLRPGGVLAIWSASRDDAFEQRLRERFGDLELLETPTDAGAPDVVYLVRAAT
FT                   AAPGELPESPA"
     gtgcacgatt tccggcaacc gccgatcacc ctggaccggg tgacgaccag ccggggtgaa        60
     ctggtgctac gcgagacgaa cggccgctac gaggtcatca gcaacggtgt cttcctgatg       120
     gacaccgcgg acggccggtc cgagcgactg ctggttgacg cggcggtgag caggtgcacg       180
     ggcccggcgc cccggctgct catcggcggt ctcggcgtcg ggttctcgct gctgcgcgcg       240
     gtcgagcacc cacacgtcgc cgccatcgac gtcgttgaga tcgaggccac cgtgatcggc       300
     tggcacgccc gccacctgcg ccccctcacc ggcgccgcgc aggccgaccc ccgggtacgg       360
     atcgtcgagg cggacatcct cgcctggttg gccgacaccg ccgaccagta cgacgccatc       420
     tgcctggaca ccgacaacgg ccccaactgg ctggtcttcg aggccaacgc cgagttgtac       480
     gcccaccgtg ggctcgacct ggtggccggc cggctccgac cggggggtgt cctggcgatc       540
     tggagcgcga gccgggacga cgccttcgag caacgactcc gggagcgctt cggcgacctg       600
     gagctgctgg agacaccgac cgatgcaggc gcaccggacg tggtctacct cgtccgggct       660
     gccaccgcgg cgccggggga gctaccggag tcgccggcat ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page