(data stored in ACNUC7421 zone)

EMBL: CP000667.PE452

CP000667.PE452       Location/Qualifiers
FT   CDS_pept        515174..515710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0452"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70, region 4 type 2"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52937"
FT                   /db_xref="GOA:A4X237"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:A4X237"
FT                   /protein_id="ABP52937.1"
FT                   /translation="MVDVDDGELLRLVGTGDRRAFELLYARNAPWLLLRLRRRCRDPEL
FT                   ARELLQETFLTVWRAAASYRGDGTAVGWLWSIASGRLIDARRRASVRPQLVNSPGEGTL
FT                   TWSPSAEDEALTHEYDAGLERALRQLPPELWTVLQATVLDGRTVREAATLLGVPEGTVK
FT                   SRAMRARQRLRAALS"
     atggtggacg tagacgatgg ggagctgttg cgcctcgtcg gtacggggga ccgcagggcg        60
     ttcgagctgc tgtacgcgcg gaacgcaccc tggctgttgc tccggctccg gcgacggtgc       120
     cgagacccgg agctggcgcg agaactgctg caggagacgt tcctgacggt gtggcgggct       180
     gcggccagct accgggggga cgggaccgcg gtgggctggc tgtggtcgat cgccagcggc       240
     cgactgatcg atgcccgacg gcgggcctcg gttcgtccgc agctcgtgaa ctcgccgggg       300
     gagggcaccc tcacctggtc gccgtcggca gaggacgaag ccctgaccca cgagtacgac       360
     gccgggttgg aacgggcgct gcgtcagctc ccgccggagt tatggacggt gctacaggca       420
     acggtgttgg acggccggac cgtgcgggaa gcggcgacgt tgctgggggt gccggaaggc       480
     acggtgaagt cccgggcgat gcgcgcccgg cagcggctac gggccgccct gtcatga          537
//

If you have problems or comments...

PBIL Back to PBIL home page