(data stored in ACNUC7421 zone)

EMBL: CP000667.PE457

CP000667.PE457       Location/Qualifiers
FT   CDS_pept        519272..520117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0457"
FT                   /product="transcription factor jumonji, jmjC domain
FT                   protein"
FT                   /note="SMART: transcription factor jumonji, jmjC domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52942"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:A4X242"
FT                   /protein_id="ABP52942.1"
FT                   /translation="MTVPQEAGVPVARMTFEEFQALGPGGLFKTDVPVVISLPESVRGL
FT                   GREGVAARLADMTVTLFTEPGDKNHPGRWETRDITLRDFFADERHLTESDTWHRVVSNI
FT                   RNSPADVNAVVGFDAEGFFGYGSSLYAANLWISHRGVFTKNHFDEFENFNIALEGRKRF
FT                   IIAPPGSRDYYPRSMLRGFGDKSQVFDLDNVDLGRYPRVAPKLAQRRDFVLEPGHMLYL
FT                   PLGWWHQAESLDPININVNFWLKSKKILRRPHVLGVALYTYAYRRVKGVYSYQPTEVSS
FT                   "
     gtgacggttc cgcaggaggc tggcgtacca gtcgcccgca tgacgttcga ggagttccag        60
     gcgctcggcc ccggcggcct gttcaagacc gacgtaccgg tggtgatctc acttccggag       120
     agtgtgcgtg ggctcgggcg tgagggtgtg gcggcccgcc tggccgacat gaccgtcacc       180
     ctgttcaccg aaccgggcga caagaaccac cccgggcgct gggagacccg ggacatcacc       240
     cttcgggact tcttcgccga cgagcgccac ctgaccgagt ccgacacctg gcaccgggtg       300
     gtgtcgaaca tccggaacag cccggccgac gtcaacgccg tggtcggctt cgacgcggaa       360
     gggttcttcg gctacggcag ttcgttgtac gcggccaacc tctggatcag ccaccgcggc       420
     gtcttcacca agaaccactt cgacgagttc gagaatttca acatcgcgct ggagggccgc       480
     aaacggttca tcatcgcgcc gcccgggtcc cgcgactact acccccggtc gatgctgcgc       540
     ggattcgggg acaagtccca ggtgttcgac ctcgacaatg tcgacctggg gcgctatccg       600
     agagtggcgc cgaagctcgc ccagcgccgc gacttcgtcc tcgaacccgg ccacatgctc       660
     tacctgccgc tcggctggtg gcaccaggcc gaatccctcg atcccatcaa catcaacgtc       720
     aacttctggt tgaagtcgaa gaagattctg cgccggccac acgttctggg tgtcgccctc       780
     tacacgtacg cctaccggcg ggtcaagggc gtatacagct accagcccac cgaggtgagc       840
     tcgtga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page