(data stored in ACNUC7421 zone)

EMBL: CP000667.PE46

CP000667.PE46        Location/Qualifiers
FT   CDS_pept        53391..54896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0046"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein, transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52531"
FT                   /db_xref="GOA:A4X0Y1"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A4X0Y1"
FT                   /protein_id="ABP52531.1"
FT                   /translation="MNAPLRRVGLVVMVLFGLLFANLNWIQAYKADDYRNSDYNGRVQV
FT                   AEYERKRGNIEAGGTALAVSKATDGELEYLRTYPGGEKYAHAIGYKPVNLADTGIEEAE
FT                   NAFLAGTSDQLIGDRLRDLVTGDETAGANVLLTVSQQAQDVAYEQLGENRKGVTKGAAI
FT                   AIDPRTGAVQALVSMPSFNPNPLASHDTDEATAAYNELQQNPDGPLKNRALGEVLPPGS
FT                   TFKIVTAAAALENGVTTETKIPAGPSWTPPTSGEPIGNAAPSICPEAEVTLMNAVTESC
FT                   NTGFAQLGVRLGADTLKEKARQFGFEQDDLTVGRLGEDGEPVAASRTGSMENADGSVDP
FT                   AALAQSSIGQRNVRMTPLQGALIAATVANDGSQMRPYLVSQILGADRTTNYYTAEPSEL
FT                   RQPVSDQVAADLREMMESVVQNGTGRNARISGYTVGGKTGTAQAGPNTPPHGWFIGFAL
FT                   DKDGNPVSAVCVLLEEAGDGGSAEAARIGGQIMRAAIASPGSR"
     gtgaacgcac cactgcgtcg ggtgggtctc gtcgtgatgg tcctgttcgg gcttcttttc        60
     gcgaacctga actggattca ggcctacaag gccgacgact accgcaacag tgactacaac       120
     ggccgggtcc aggtcgccga atatgagcgc aagcgcggca acatcgaggc cggtggtacg       180
     gcgctcgcgg tcagcaaggc gaccgacggg gagctggagt acctgcgcac ctacccgggc       240
     ggggagaagt acgcccacgc gatcggctac aagccggtca acctggccga caccggcatc       300
     gaggaggcgg agaacgcctt cctggccggc accagcgatc agctgatcgg tgaccggctg       360
     cgggacctgg tcaccggcga cgagaccgct ggcgcgaatg tcctgctcac cgtctcccag       420
     caggcgcagg acgtcgcgta cgagcagctg ggggagaatc gcaagggggt caccaagggt       480
     gcggccatcg cgatcgaccc gcgtaccggg gcggtgcagg cgctggtctc catgccgagc       540
     ttcaacccga acccgttggc cagccacgac accgacgagg ccacggcggc ctacaacgag       600
     ttacagcaga acccggatgg gccgctgaag aaccgggcgc tcggcgaggt gctcccgccg       660
     ggctccacct tcaagatcgt gacggctgcc gccgcgctgg agaacggtgt cacgacggag       720
     acgaagatcc ctgctgggcc cagctggacc ccgccgacct ccggcgagcc gatcgggaac       780
     gcggccccct ccatctgccc ggaggcagag gtcaccctga tgaacgcggt gaccgagtca       840
     tgtaacaccg gcttcgccca gctcggtgtg cgcctcggcg cggacaccct caaggagaag       900
     gcacggcagt tcggtttcga gcaggacgac ctgaccgtcg gccggctcgg tgaggacggc       960
     gaaccggtcg cggccagtcg gaccggcagc atggagaacg ccgacggcag cgttgacccg      1020
     gctgccctcg cccagtcctc catcggccag cgaaatgtgc ggatgacccc gctccagggc      1080
     gccctgatcg ccgccaccgt cgccaacgat ggcagccaga tgcggccgta cctggtcagt      1140
     cagatcctcg gcgctgatcg caccaccaac tactacaccg ccgagcccag cgagttgcgc      1200
     cagccggtca gtgaccaggt cgccgccgac ctgcgggaga tgatggagag tgtcgtccag      1260
     aacggcaccg gccgcaacgc ccggatcagc ggctacaccg tcggcggcaa gaccggcacg      1320
     gcacaggctg gcccgaacac gcccccccac ggctggttca tcggcttcgc gctcgacaag      1380
     gacggcaacc cggtctccgc ggtctgtgtc ctgctggagg aggccggcga cgggggcagc      1440
     gccgaggccg cccggatcgg cgggcagatc atgcgggcgg cgatcgcctc tccggggagc      1500
     cgctga                                                                 1506
//

If you have problems or comments...

PBIL Back to PBIL home page