(data stored in ACNUC7421 zone)

EMBL: CP000667.PE461

CP000667.PE461       Location/Qualifiers
FT   CDS_pept        523173..524525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0461"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52946"
FT                   /db_xref="UniProtKB/TrEMBL:A4X246"
FT                   /protein_id="ABP52946.1"
FT                   /translation="MSGAESIAAAGHPWFGDQRLAPTAPADTLRHRLRSVLHKTGWPYQ
FT                   PVLPAAPMTIPRASYAELFRVAGVLVELLRRTALEAAPSTRERLAAYRMPASEDQLWLC
FT                   DPLLDERYADCVARPDVVIGPDGPQFVEFNVSGALAGVVETQSRLDVWRGLYADGAGRL
FT                   PYRSPDPFAVRAEMFRSLAAELAVAPRVAIVGSAQVAGVTSHYFEVEAEYHRSQGLAAR
FT                   FFEPKELHEAWDCPPGLRYSVGLRNFTIPDWADAGVPTATVQEALDHGCLLVGTQTSTF
FT                   LHSKLTMGLLSEGRPWMTTAERDLVNRYLPWTRVLSERWTERAGEQVDLLPYVLRNRER
FT                   LVLKEALGDCGKQVVIGREVPPSKWEAAVAAGAAGASIVQEFVPPQTCRVALLADGADE
FT                   PHDADVAPVLGPLLFGRRPAGVFCRYRTDGTAGIVNARGSATGADNAMVAF"
     atgagcgggg ctgaatcgat cgccgcggcg ggacacccgt ggttcggcga ccaacggctg        60
     gcgccgaccg cgccggcgga cacgctccgg caccgcctgc gcagcgtgct gcacaagacc       120
     ggctggccgt accagccggt gctgccggcc gcgccgatga ccatcccccg tgcctcgtac       180
     gcggagctct tccgggtggc cggtgtcctg gtggagctgc tgcgacggac cgccctggag       240
     gccgcgccca gcactcggga gcggctggcg gcctaccgga tgccggccag cgaggaccaa       300
     ctctggctgt gtgacccgtt gctcgacgag cggtacgcgg actgcgtggc gcggccggac       360
     gtggtcatcg gcccggatgg tccgcagttc gtggagttca acgtcagtgg cgcgctcgcc       420
     ggcgtggtgg agacgcagag ccgcctcgac gtgtggcgcg ggctgtacgc cgacggggcg       480
     ggtcggctgc cgtatcgctc gccggatccg ttcgccgtac gcgccgagat gttccgctcg       540
     ctcgccgcgg aactggcggt ggcgccccgg gtggccatcg tcggcagtgc ccaggtcgcg       600
     ggggtgacca gtcactactt tgaggtcgag gccgagtacc accgcagcca ggggctggcc       660
     gcccggttct tcgagccgaa ggagctgcac gaggcgtggg actgccctcc ggggctgcgc       720
     tattcggttg ggctgcgtaa tttcacgatc ccggactggg ctgacgcggg cgtccccacc       780
     gccacggtgc aggaggcgct ggaccacggt tgcctgctgg tggggacaca gacctccacc       840
     ttcctgcaca gcaagctgac catggggttg ctctcggagg gacggccgtg gatgaccacg       900
     gccgagcggg acctggtcaa ccgctacctg ccgtggaccc gggtgctctc cgagcggtgg       960
     accgagcgcg cgggtgagca ggttgacctg ctgccgtacg tgctacgcaa ccgcgagcgg      1020
     ctggtgctca aggaggcgct gggggattgc ggcaagcagg tggtgatcgg tcgagaggtg      1080
     cctccctcga agtgggaggc cgcggtggcg gccggggccg ccggcgccag catcgtgcag      1140
     gagttcgtgc cgccccagac ctgccgggtg gcgttgctgg cagacggcgc cgacgaaccc      1200
     cacgatgccg atgtcgcccc ggtgctgggg ccgctgctgt tcggccgtcg accggccggg      1260
     gtgttctgcc gctaccgcac cgacggcacg gccggcatcg tcaacgcccg gggatcggcc      1320
     accggggcgg acaacgccat ggtggcgttc tga                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page