(data stored in ACNUC7421 zone)

EMBL: CP000667.PE462

CP000667.PE462       Location/Qualifiers
FT   CDS_pept        524576..525067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0462"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52947"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A4X247"
FT                   /protein_id="ABP52947.1"
FT                   /translation="MTLRRVSDHEYVEEHGGDYEDFEPGMVIRHWPGRTLSEADNTWLT
FT                   LLTMNQHPLHFDQHYAAGVEYGRVLVNSGITLCLIGGMTVQALSARAVANLGWDKVRLK
FT                   EPVFVGDTLYATSRILHKRLSRSRPGNGIVTVETTGTKANGEQVIVFERSFLVRCRQAG
FT                   "
     atgacgctac gccgagtcag cgaccacgag tacgtcgaag agcacggcgg ggactacgag        60
     gacttcgaac ccgggatggt tatccggcac tggccgggcc gcaccctctc cgaggccgac       120
     aacacgtggt tgacgctgtt gacgatgaac cagcacccgc tgcacttcga ccagcactac       180
     gccgccggcg tcgagtacgg ccgcgtactg gtcaacagcg gcatcaccct gtgcctgatc       240
     ggcgggatga ccgtgcaggc gctctccgcc cgcgcggtgg ccaatctggg ctgggacaag       300
     gtgcgtctca aggagcccgt cttcgtcggg gacaccctct acgcgacgag ccgaatcctg       360
     cacaagcggc tgtcgcggtc gcgtcccggc aacggcatcg tgacggtgga gacgacgggt       420
     acgaaagcga acggggagca ggtgatcgtc tttgagcgat ccttcctggt tcgttgccgg       480
     caagccggct ga                                                           492
//

If you have problems or comments...

PBIL Back to PBIL home page