(data stored in ACNUC7421 zone)

EMBL: CP000667.PE469

CP000667.PE469       Location/Qualifiers
FT   CDS_pept        531533..532018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0469"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52954"
FT                   /db_xref="InterPro:IPR025850"
FT                   /db_xref="UniProtKB/TrEMBL:A4X254"
FT                   /protein_id="ABP52954.1"
FT                   /translation="MNDRFPPLVTEALQAAGWVPGRRDDDRAQQWALRLAADAAPDGRQ
FT                   HTIVRAAVEAYGEFGGLLVRPQGDGEQIAPSTFHLDPFLVGRSVGTLAELAAAIGAPLT
FT                   PIGEEGDGVGILAVDEPGRVFVLDHGGDWYLGADLDEAITALVLGRQPHRVRQDGTW"
     atgaacgacc gcttcccacc cctggtcacc gaggcgcttc aggccgctgg ctgggttccg        60
     ggccgtcgtg atgacgatcg ggctcagcag tgggcgttgc ggctggctgc tgatgccgca       120
     ccggacggcc ggcagcacac gatcgtccgt gccgctgtcg aggcgtacgg cgagttcggt       180
     ggcctcctgg ttcgtccgca gggcgacgga gaacagatcg cacccagcac gttccacctg       240
     gatccgtttc tggtcggccg ttcggtgggc accctcgccg agctcgccgc ggccatcggg       300
     gcgccgctca ccccgattgg cgaggagggc gacggcgtcg gcatcctggc ggtcgacgaa       360
     ccggggcgag tgttcgtgct ggaccacggc ggcgactggt acctcggcgc ggacctcgat       420
     gaggcgatca ccgcgctggt gctgggccgg cagccccacc gggtacgcca ggacggaacg       480
     tggtag                                                                  486
//

If you have problems or comments...

PBIL Back to PBIL home page