(data stored in ACNUC7421 zone)

EMBL: CP000667.PE472

CP000667.PE472       Location/Qualifiers
FT   CDS_pept        complement(534703..536283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52957"
FT                   /db_xref="UniProtKB/TrEMBL:A4X257"
FT                   /protein_id="ABP52957.1"
FT                   /translation="MTDQYYGWTPTLAGFAGGGDDYVADQAAQSTPYEPTQWDGVTIEQ
FT                   MWEYARRESDERTVALAETWRRTSILLQSTRENLKRHADGLRAKWRSPAGELFMSKVGA
FT                   ALYSLDEWKDVADKNANGLEQIASKIAQTQRDMRELWLTYQAEQKHQAQKRKADEGIQF
FT                   GDIFGLNNGKSYTEVQKEFHERAKNIVKPLAELYIDVYISNISRGGKYKGPTNIAEYNP
FT                   GQSPRPERPSAPIRPRPPAPNLLGGRPEMLARLDVTPPPSSPELSDGIGLAGGTVTAPS
FT                   PTPGPPPAATPPISPTPTPAPAPLPPPVLRGVSSPGTAQPTTPSTTRPSNAPRTTLPGA
FT                   NNPDARGPAPNRPAPPNTGKPGGSPAHRGPTPNQATLPGNTGTGRPPAGSIPPRPTPPP
FT                   PNLSGKHSTSRAASGPRTSSPSVGRPAPPPTTGRPTPPNGGSPLTGRTAAGGTRPAPTT
FT                   GPAPSLGGRRGAPTTPRPPARARPEETENWKYGEGDDELWVTDPAPAGTIDAPAENQPR
FT                   HHGKALGQG"
     atgacagacc agtactacgg atggactcca accctggcgg gattcgccgg cggcggtgac        60
     gactacgtcg ctgaccaggc cgcccagtcc acaccctatg agcccaccca gtgggatggg       120
     gtcaccatcg agcagatgtg ggagtacgcc cgtagagaaa gcgacgaacg caccgtcgcc       180
     ctcgctgaga cctggcgccg cacgagcatc ctgctacaga gcacccggga gaacctgaag       240
     cgacacgccg atggactccg ggccaaatgg cgctcaccag ctggcgagct cttcatgagc       300
     aaggtgggag cggccctcta ctcactggac gagtggaagg acgtcgccga caagaacgcg       360
     aacggcctgg agcagatcgc cagcaagatc gcacaaaccc agcgggacat gcgcgagctc       420
     tggctgacgt accaggccga gcagaagcac caagcacaaa agcgtaaagc cgacgaaggc       480
     attcagttcg gcgacatctt tgggttgaac aacggaaaat cgtatacgga ggtgcagaag       540
     gagtttcacg agcgcgcgaa gaacatcgtc aagccgctgg cagagcttta catagatgtc       600
     tacatctcga acatttcccg cgggggtaaa tacaaggggc cgacgaacat agccgaatac       660
     aatcccgggc agtccccgcg accagaacgg ccgagcgcgc cgatccggcc gaggccgcct       720
     gcgccgaacc tgctcggtgg ccggccggag atgctcgccc gcctcgacgt gacgccaccg       780
     ccctcctcgc cggagctgtc cgacggcatc ggactcgctg gcggcaccgt gaccgcgccg       840
     tctccgacgc ccgggccccc accggcggcc acaccgccga tctcgcccac acccacaccc       900
     gcgcccgcgc cgctgccccc gccggtgctt aggggcgtca gcagcccagg gactgcacaa       960
     ccgaccacgc catccaccac ccgcccgtca aacgcccccc gcacgacact gccgggagcc      1020
     aacaaccccg acgcccgcgg ccccgcaccc aatcggcccg cgccccccaa cacgggcaag      1080
     cccggcggta gcccggcgca tcgtggcccc acaccgaacc aggccacgct gcccggcaac      1140
     acaggcaccg gacgaccacc cgcaggaagc atcccacccc gcccgacacc accgccaccg      1200
     aacctcagcg gcaaacacag caccagccgc gccgcctccg gcccacgcac cagttcccca      1260
     agcgtcggcc gtcccgcccc gccgccgacc accggccgcc ccaccccgcc aaacggcggc      1320
     agccccctca ccggtcggac cgcggccggc ggcacccgac cagctcccac cacgggaccc      1380
     gcgccatcgc taggcggtcg ccggggcgcc cccaccaccc cccgtcctcc cgccagagca      1440
     cgccctgaag agacggagaa ctggaaatac ggcgaaggcg acgacgaact ctgggtcacc      1500
     gacccggccc cagccggcac catcgacgca ccggcagaga accagccacg gcaccacggc      1560
     aaagccctcg gtcaaggctg a                                                1581
//

If you have problems or comments...

PBIL Back to PBIL home page