(data stored in ACNUC7421 zone)

EMBL: CP000667.PE473

CP000667.PE473       Location/Qualifiers
FT   CDS_pept        complement(536319..537080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52958"
FT                   /db_xref="UniProtKB/TrEMBL:A4X258"
FT                   /protein_id="ABP52958.1"
FT                   /translation="MALAPPEWILSLRLRTCAIRIEALIRQMRSQDAHMRRSQTDDRGG
FT                   IMGDDWLVSENIDVNIQQLKDFAQAIQNELETNFRPSYQGGVLPMLQVQAPFGGGGMNE
FT                   GRFFRGRHDESRLAVIRLLEDAMQGMVSLSTVSMSISADYLTEDALVEATNTDVLNAFS
FT                   TVDGQQTLNNGVQQGDNEHGNSTDSLPPGAFGSTVTHLEQSVGLDGNTGEAPLMDQPET
FT                   VGEGSGAYRIQGDDERMHGDEVTPPDVDLRG"
     gtggcgctag ctccaccaga gtggatactc agcctgcggc tgagaacctg cgccatccgg        60
     atagaggccc taatcagaca gatgcgcagc caggacgcac acatgcgccg ctcgcagacg       120
     gatgatcggg gaggaatcat gggcgacgac tggctcgtca gcgagaacat cgacgtcaac       180
     atccagcagt tgaaagactt cgcgcaggct atccagaacg agctggagac caactttcga       240
     cccagctacc agggtggcgt gctcccaatg ctccaagtgc aggcgccgtt cggcgggggc       300
     ggaatgaacg agggccggtt ctttcggggc cggcacgacg aaagccgcct ggcggtgatc       360
     cgccttctcg aagatgcgat gcagggcatg gtctctctca gcaccgtttc catgtcgatt       420
     tctgccgatt acctcactga agacgcgcta gtcgaggcca ccaacaccga tgtgctcaat       480
     gccttctcta cagttgacgg gcagcagact ctcaacaacg gcgtccagca gggcgacaac       540
     gagcacggga actcgaccga ctcgctccca ccgggggcct tcggctcgac agtcacccac       600
     ctcgagcaaa gcgttggcct ggacggcaac accggggaag ctcccctgat ggatcagccg       660
     gagacggtcg gtgagggctc cggcgcatac cggatccagg gcgatgatga acggatgcac       720
     ggtgacgagg tgaccccacc ggatgtcgac ctgcggggtt ga                          762
//

If you have problems or comments...

PBIL Back to PBIL home page