(data stored in ACNUC7421 zone)

EMBL: CP000667.PE476

CP000667.PE476       Location/Qualifiers
FT   CDS_pept        complement(542592..543353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52961"
FT                   /db_xref="InterPro:IPR025850"
FT                   /db_xref="UniProtKB/TrEMBL:A4X261"
FT                   /protein_id="ABP52961.1"
FT                   /translation="MISRDEALARARRWAAAGRPGPPPEVDFYEFDLGFVASRREPLRF
FT                   APDGTPKPPSATGQPTVVIDRGTGRLSSWPPLSNQEIAEWYGKYHAAEGRFPPDVREVL
FT                   DQAGWFPGRDMTAAVDLWLARFADELAGLECFPAVRAALIEFGGLILPQLGRSGEPGAG
FT                   FASGIQPTRTGGVLADCSEIFAEEFNNPVFPLGNNADGPSELVMDAQGRVFQLHWADDF
FT                   FIGPDIDTAIIALIRGGRMPAASDLTWRTDN"
     atgatcagcc gtgacgaggc gctggctcgc gcccggcggt gggccgccgc cggccggccc        60
     ggcccgcccc cagaggtcga cttctacgag ttcgacctcg gctttgtcgc ctcccgccgc       120
     gaacccctgc ggtttgcacc ggacggaacg cccaagccac cgtcagcaac cggacagccc       180
     accgtggtaa tcgaccgggg aaccggaaga ctgtcgagct ggccgccgct atccaatcag       240
     gaaattgctg agtggtatgg gaagtaccac gcggccgagg gtcgctttcc acccgacgtg       300
     cgtgaggtct tggaccaggc cggatggttc cccggtcggg acatgaccgc cgccgtcgac       360
     ctctggctgg ctcgcttcgc cgacgagctc gccggcttgg agtgcttccc cgccgtgcgg       420
     gctgccctaa tcgagttcgg tggactcatc cttccccagt tgggcagaag tggggaaccc       480
     ggcgccggat tcgccagcgg catccaaccc accaggactg ggggggtcct agccgactgc       540
     tccgagatct tcgctgagga gttcaacaat cccgtcttcc ctctcggcaa caatgccgac       600
     ggcccctccg agcttgtcat ggacgctcag gggcgggtct tccaactaca ttgggccgac       660
     gacttcttca tcggcccaga catcgacacc gctatcatcg ccctcattcg cggtggacga       720
     atgcccgcag ccagcgacct cacctggcgg accgacaact ag                          762
//

If you have problems or comments...

PBIL Back to PBIL home page