(data stored in ACNUC7421 zone)

EMBL: CP000667.PE477

CP000667.PE477       Location/Qualifiers
FT   CDS_pept        543491..544930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0477"
FT                   /product="protein of unknown function DUF690"
FT                   /note="PFAM: protein of unknown function DUF690"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52962"
FT                   /db_xref="GOA:A4X262"
FT                   /db_xref="InterPro:IPR007795"
FT                   /db_xref="UniProtKB/TrEMBL:A4X262"
FT                   /protein_id="ABP52962.1"
FT                   /translation="MPSRRDQVQSYQFFVQRMTSALVAREPDPATAAPFRRLGGAGFAS
FT                   IMVAVLCLAAVGVYGLLRPGGATKWKEESAVILEKETGSRYIYQEDRLYPVINYSSALL
FT                   ALGSAAQTVSVSRNSLVGTPRGTRIGIRDAPDALPDPKRLLSGPWTLCTQLAHDSAGGA
FT                   VATTVLTVGAAPSGGREMDEAALLVRDTATNRLHLIWQDHRYEIRDENVVLEGLTMTTE
FT                   PVVEVGGAWLNALPAGESIGISEVVDRGEPSRALQDARIGQIFVVESQNGGRQYYLAER
FT                   DQLRSLTQLQAEVLLADPKATRAYPDGSPPEPISLPAGVAASAQKAPPVAEGSHRAPAE
FT                   RPEIVQLRGDEPAVCAVYQPGQSEPTLLLEGRVRPEEGLLRTAEQTSAGIPLADRVVVE
FT                   PGHGVLVEAMPAPEAPTGALSLVTDLGYRYPLPSNEVAGLLGYGGVQPVEMPASLVVRL
FT                   PAGPVLDPTAAKQALGPELPQ"
     atgccatcgc ggcgggacca ggtccagtcg taccagttct tcgtccagcg gatgacctcc        60
     gcgctcgtgg cccgggagcc cgatccggcg accgccgcgc cgtttcggcg gctcggcggt       120
     gccggcttcg cgagcatcat ggtggccgtg ctctgccttg ccgcggtggg cgtctacggg       180
     ctgctgcgcc caggtggcgc caccaagtgg aaggaggagt cagcggtcat tctggagaag       240
     gagaccggca gtcggtacat ctaccaggag gaccggctgt acccggtgat caattactcg       300
     tctgcgctgc tggcgttggg atcggcggcg cagacggtct ccgtctcccg gaactcgttg       360
     gtcggcaccc cacgcggcac ccggatcggc attcgggacg caccggacgc gctgcccgac       420
     ccgaagcggc tcctctccgg gccgtggacg ctctgcaccc agctggccca tgactcggcg       480
     ggtggtgccg tcgccaccac ggtgctcacc gtcggcgcgg cccccagcgg tgggcgggag       540
     atggacgagg ccgcgctcct ggttcgcgat accgcgacga accggctgca cctgatctgg       600
     caggaccacc ggtatgagat ccgtgacgaa aatgtcgtcc ttgaaggact caccatgacc       660
     acggagcccg tggtcgaggt gggcggagcg tggttgaacg cgctaccggc gggtgagtcc       720
     atcgggattt cggaggtagt cgatcggggt gagccgtcac gcgcactgca ggacgcccgg       780
     atcggccaga tcttcgtcgt ggaaagccag aatggcggcc gtcagtacta cctcgcagag       840
     cgggatcagc tacggtcgct gacccagctt caggccgagg tgctgttggc cgacccgaaa       900
     gccacgcgtg cgtacccgga tgggtcacca cctgagccga tctcgctccc ggccggtgtc       960
     gccgcgtcgg cccaaaaggc gccgccagtg gccgagggga gtcaccgcgc acccgcagag      1020
     cgtccggaga tcgtccagct ccgcggcgat gaaccggctg tctgcgccgt ctaccaaccg      1080
     gggcaaagcg agccgaccct gctgctggag gggcgggtgc ggccggaaga gggactgcta      1140
     cgaacggccg agcagaccag tgcggggatt cccctcgctg accgggtggt ggttgagccg      1200
     gggcacggcg tgctggttga ggcgatgccg gcaccggagg cgccgacagg tgccctgagc      1260
     ctggttaccg acctcggtta ccgatatccg ttgccgtcga acgaggtggc gggattgctt      1320
     ggctacggcg gcgtgcagcc cgttgaaatg ccggcgagcc tggtcgtccg acttcccgcc      1380
     ggccccgtgc tcgacccgac cgccgcgaag caggcgctcg gtccagagct cccacagtag      1440
//

If you have problems or comments...

PBIL Back to PBIL home page