(data stored in ACNUC7421 zone)

EMBL: CP000667.PE478

CP000667.PE478       Location/Qualifiers
FT   CDS_pept        545073..545402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52963"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:A4X263"
FT                   /protein_id="ABP52963.1"
FT                   /translation="MTMRTDTGLMVKTEGDVDAVADRLTSNLNQLMDQLAPLYDQWKGA
FT                   GAGSFQQVRQRFDQDMARLNVALRAIAEAVGSAGKDYDVADDEIKSDMDAAGATAGKIT
FT                   TALKL"
     gtgacgatgc gtaccgacac cggcctgatg gtgaagaccg agggtgacgt agacgccgtc        60
     gccgaccggc tcaccagcaa tctgaaccag ctgatggacc agctggcgcc gctgtacgac       120
     cagtggaagg gtgctggtgc gggctcgttc caacaggttc gccagcggtt cgaccaggat       180
     atggcgcggc tgaacgtagc gctgcgagcg atcgccgagg ccgtcgggtc cgccggtaag       240
     gactacgacg tggccgatga cgagatcaag tccgacatgg atgctgctgg cgctacggcc       300
     ggaaagatca ccacagcgct gaagctctga                                        330
//

If you have problems or comments...

PBIL Back to PBIL home page