(data stored in ACNUC7421 zone)

EMBL: CP000667.PE481

CP000667.PE481       Location/Qualifiers
FT   CDS_pept        547220..547657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0481"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52966"
FT                   /db_xref="GOA:A4X266"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:A4X266"
FT                   /protein_id="ABP52966.1"
FT                   /translation="MDRRWQHMDVQGEDAMDIQALRARADELMNQFERMRSGVGGLQQR
FT                   LKEVNATVTSDDGFVTVTVGPRGHVAKVEFDPRLYRRPNSKELSATVTATIQRATEKAL
FT                   AEVEELLRPFVPDSQFQAYLDHDLTGIFGQLERELPREGDR"
     ttggacagac ggtggcagca catggacgtg cagggggagg acgccatgga cattcaggca        60
     ctgcgtgcgc gcgcagatga gctgatgaac cagttcgagc ggatgcgctc gggcgtggga       120
     ggtctccaac agcggctaaa agaagtaaat gcgactgtca cgtcggacga cggttttgtc       180
     acggtcaccg tgggcccgcg tggtcacgta gccaaggtgg aattcgaccc acgtctctat       240
     cggcggccga actcgaagga gctctccgcg accgtgacgg ccacgatcca gcgggctact       300
     gagaaggctc tggccgaggt tgaggagcta ctccggccct tcgtgccgga cagccagttc       360
     caggcctacc tggaccatga cctaacaggc atctttggtc agctcgagcg tgagcttccg       420
     cgggaggggg atcgatga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page