(data stored in ACNUC7421 zone)

EMBL: CP000667.PE482

CP000667.PE482       Location/Qualifiers
FT   CDS_pept        547654..547992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0482"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52967"
FT                   /db_xref="UniProtKB/TrEMBL:A4X267"
FT                   /protein_id="ABP52967.1"
FT                   /translation="MTDAAETFVHPEGVRAGAGQLGAAGSMLARRWAQHAATIEMLNGN
FT                   SPWGADEYGKEFNKHYLGGDAIATTVLDGGQTIVERVQLLGPIVSSAVDGTVEMDEAVR
FT                   TMFGSDDT"
     atgaccgatg cagccgagac ctttgtgcat ccagagggcg tgcgagctgg ggcgggccag        60
     ctcggtgccg ccggctcgat gctcgcccga cgttgggcgc agcacgcggc cactatcgag       120
     atgctgaacg gcaacagccc ctggggtgcc gatgagtatg gcaaggagtt caacaagcac       180
     tacctggggg gtgacgcaat cgccaccacc gttctcgacg gcggtcagac aattgtggag       240
     cgtgtgcagc tcctcggccc cattgtgagc agtgcggttg acggcaccgt cgagatggac       300
     gaggcagtca ggacaatgtt tggcagcgac gacacctag                              339
//

If you have problems or comments...

PBIL Back to PBIL home page