(data stored in ACNUC7421 zone)

EMBL: CP000667.PE489

CP000667.PE489       Location/Qualifiers
FT   CDS_pept        564615..565061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0489"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52974"
FT                   /db_xref="UniProtKB/TrEMBL:A4X274"
FT                   /protein_id="ABP52974.1"
FT                   /translation="MDIEALLPRARTPRDYLDLVTDPRVDQDGLHTLARSPYSFVRLAI
FT                   AKDIRTSPATLTELLLGEFDQWDRNYLLRLVAQHPQADRVVLLKVLHATEVLLRQSGAR
FT                   PYGVAIALASRHELAPHEVRRAHRLPGASRRMRRGVERALARRQ"
     gtggatatcg aagcgctgct tccacgggca cgtacacctc gggactacct ggacctcgtt        60
     acggaccccc gagtcgatca ggacgggctg cacactcttg ctcgtagtcc ctactcgttt       120
     gtgcggctgg ccattgccaa ggacatccgc acgagtccgg caaccctgac cgagctactc       180
     ctcggcgagt tcgaccagtg ggaccgtaac tacctgctcc ggctcgttgc tcagcacccg       240
     caggcggacc gagttgtcct gctcaaggtc ctacacgcga ctgaggtcct actacgccag       300
     tccggcgcga gaccgtatgg cgtagcgatt gcgctggcca gtcgacacga gttggcgcct       360
     catgaggttc gtcgcgcgca tcgtctgcca ggtgcgtcgc gaaggatgcg tcgaggcgtg       420
     gagcgggcac tcgcacgtcg acaatga                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page