(data stored in ACNUC7421 zone)

EMBL: CP000667.PE490

CP000667.PE490       Location/Qualifiers
FT   CDS_pept        complement(565585..566049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0490"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52975"
FT                   /db_xref="InterPro:IPR025355"
FT                   /db_xref="UniProtKB/TrEMBL:A4X275"
FT                   /protein_id="ABP52975.1"
FT                   /translation="MPGAAALPCTRYGESKGSIMGAWGPGPFDNDTACDWGYELDDAVR
FT                   ADRVAVLRSALIAAADQSGHLGHTEAAEAVGAAAIVAAFQPGGPPLDPIYSPDCLRADG
FT                   LDVPPELVDLAARALDRVMGGDSEWRELWAEAGRLDDVTAVLAPIRASLT"
     gtgcccggcg cggctgctct accgtgcacg cggtatggcg agagcaaggg gtcaatcatg        60
     ggcgcatggg gtccgggtcc tttcgacaac gacacagctt gcgattgggg ctacgagctg       120
     gacgacgcgg tgcgtgctga ccgcgtggcc gtgctccgta gcgcgttgat cgcagcggca       180
     gatcagagcg gacatctcgg tcatacggag gcagcagagg cggtaggcgc tgcggcgatc       240
     gtggcggcgt tccagcctgg cggcccgcca ctcgatccga tatacagccc cgactgccta       300
     cgtgcggacg ggttggacgt gccgccggag ctggttgacc tggcggcacg ggcgctcgac       360
     cgcgtgatgg gtggcgattc agagtggcgg gagttgtggg ccgaggctgg tcgacttgac       420
     gacgttactg ccgtcctcgc tccaatccgt gcgtccctca catga                       465
//

If you have problems or comments...

PBIL Back to PBIL home page