(data stored in ACNUC7421 zone)

EMBL: CP000667.PE492

CP000667.PE492       Location/Qualifiers
FT   CDS_pept        567472..570363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0492"
FT                   /product="transcriptional regulator, winged helix family"
FT                   /note="PFAM: transcriptional regulator domain protein;
FT                   transcriptional activator domain; Tetratricopeptide TPR_4"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52977"
FT                   /db_xref="GOA:A4X277"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR002182"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A4X277"
FT                   /protein_id="ABP52977.1"
FT                   /translation="MAGPAVRIRLLGGVEVVDGSGTAVDIGAGKCRALLAALAMQPGRA
FT                   IPDWRLIDLLWGEQPPRTAVRTLQSYIARLRGGLGAGRIVRSGASYRLDVPADAVDVIR
FT                   FGRRVEAGDVAGALAEWTGDPLAGVPVPGLAATVDGLVEQWLGAVEADLTARVDADAAA
FT                   TVGPLTELSARYPFREGLWALLMTALYRVGRQADALTAYRTARQQLVEHLGVEPGPRLR
FT                   RLESAILDQDPRIGGERRSEPVHRLPRRAVRLIGRDGDLDLIGRALDESPVVTLVGPGG
FT                   IGKTALAVAAAQRTRLEHGAWLVDLTEITTDQDVPQAVAAAVRVEEGPGRSLSESIVLS
FT                   LSSLRALLVLDNCEHVADGAARLAQAVADGCPQVRVLATAREPLGLSHGHERLVAVTPL
FT                   PAAGAGADLFAERANALTAAFTTGAAREVIEEICRCLDGLPLAIELAAAQTVSHTPQEI
FT                   RERLDDQLGLLVGGRRTGADRHRTMRATIQWSYRLLTVAEQDLLQRLSVFAGPVDRAGA
FT                   AAVAAGSGLDVNDVLHTLVQRSMVTAEPGRFGQQFRLLEPVRQFAAEHLAAGSAAAPAQ
FT                   AAHTRYVRERVTSLHDQLTGTAEIQGVAHLDELWPNLRVAVDRAFACGDYRLAHDLFRP
FT                   IGTEALRRHRHEIGQWAQRLLEQAPAEDRPRVVAGLIAAGPRYHLRQDPAGFDTLVRQY
FT                   GDPDDPVARHMRANVHDDYAAQIHSAPQALAELRRLGADDLAAHVEVDLGAALVFQGQY
FT                   ARGDTKLTELADRFRSDGPPTLLNWTLMLLGFSAAFQGRRAAADQLFDQAVDVPLPVRT
FT                   HSPNQSVRAQALFRRGDRRAAYQLLRAHVEELLDADNMHGACVVSISFVTMMPAVARFA
FT                   EGARVLAFLDTAGLLDNVAWAAMVADARDELATFAPAFDESTIADQRQALVAIGDTLDD
FT                   LLAEQTSRPDANSIFNLLGGGIDPRRSWEQSLD"
     atggcagggc cggcggtacg catacggttg ctcggcgggg tcgaggtggt ggacgggagc        60
     ggcaccgccg tcgacatcgg ggcgggtaag tgccgtgcgc tgctggcggc tctggcgatg       120
     cagcccggca gggcgattcc ggactggcgg ctgatcgatc tgctgtgggg tgagcagcca       180
     ccccggactg ccgtccggac cctgcagtcg tacatcgcgc ggctacgggg cggtctgggt       240
     gccgggcgga ttgtgcgctc gggtgcctcg taccgtctcg atgtgcccgc cgatgcggtc       300
     gatgtgatcc ggttcggccg gcgggtcgag gccggcgacg ttgccggggc gctcgccgag       360
     tggaccggcg atccgctggc cggggtgccg gtgccgggcc tggctgcgac cgtggacggc       420
     ctggtcgagc agtggctcgg cgcggtcgaa gccgatctca ccgcccgggt ggacgccgac       480
     gccgcagcga ccgtggggcc gttgactgag ctgagcgcgc ggtatccgtt ccgtgaaggg       540
     ctctgggcgc tgctgatgac ggcgctgtac cgggtgggcc ggcaggccga cgcgctgact       600
     gcgtaccgca ctgcccgtca gcagctggtt gagcacctgg gtgtggagcc cgggccgcga       660
     ttgcgccgcc tggagtcggc gattctcgac caggaccccc gtatcggcgg cgagcggcgg       720
     tccgagccgg tccaccggct gccccggcgc gccgtgcgac tgatcggccg tgacggtgac       780
     ctcgacctca tcggccgggc gttggacgag agcccggtgg tcaccctggt cgggccgggc       840
     ggcatcggca agaccgcgct cgccgttgcg gccgcccaac gcacccggct cgagcacggc       900
     gcctggctgg ttgacctgac cgaaatcacg accgaccagg acgtacccca agcggtcgcc       960
     gcggcggtgc gcgtcgagga aggcccaggc cggtcgctga gcgagtccat tgtgctgtcc      1020
     ctgagctccc tgcgggcact acttgtgctc gacaactgtg aacacgtcgc ggacggcgcg      1080
     gcgcgcctgg cccaggccgt cgccgacggc tgcccgcagg tgcgggtgct ggccaccgcg      1140
     cgggaaccgc tcggcctcag ccacggccac gaacggctgg tggccgtgac gccgttaccc      1200
     gcggccgggg ccggggccga tctgttcgcc gaacgtgcga acgcgctgac cgccgcgttc      1260
     acgacgggcg ccgcgcggga ggtgatcgag gagatctgtc gctgcctcga cgggcttccc      1320
     ctcgccatcg agctggccgc cgcccaaacc gtcagtcaca ccccgcagga aatccgcgag      1380
     cgtctcgacg atcagctcgg cttgctggtc ggcggacggc ggaccggggc ggaccggcac      1440
     cgcaccatgc gcgccacgat ccagtggtcc taccggctcc tcaccgtggc cgaacaggac      1500
     ctgctgcaac ggctgtcggt gttcgccggc ccagtcgacc gggccggagc tgcggccgtt      1560
     gccgccggca gcggcctgga tgtcaacgac gtgctgcaca ctctcgtaca gcgctcgatg      1620
     gttaccgccg aacccggccg gttcggccag cagttcaggc tgctggaacc agtccgccag      1680
     ttcgcagccg aacacctcgc cgcaggatcg gcggccgcac ccgcccaggc cgcgcacacc      1740
     cgatacgtgc gggaacgggt gacctcgctg cacgaccagc tcaccggaac cgccgaaatc      1800
     cagggggtcg cccatctgga cgagctgtgg cccaacctgc gcgtagcggt tgaccgggcc      1860
     tttgcctgcg gcgactaccg cctcgcccat gacctgttcc ggccgatcgg caccgaggcc      1920
     ctccggcggc accggcacga aatcgggcag tgggcgcaac gcctccttga acaggcaccg      1980
     gctgaggatc ggccgcgggt cgtggccggc ctgatcgccg ccggaccccg gtatcacctc      2040
     cgtcaggacc cggccgggtt cgacaccttg gtcaggcagt acggcgatcc ggacgatccg      2100
     gtggcccggc acatgcgggc caacgtccac gacgactacg ctgctcagat tcactcggcg      2160
     ccgcaggcgc tggccgagct gcgccggctc ggcgccgacg atctcgccgc gcatgtcgag      2220
     gtcgacctcg gcgcagcgct ggtctttcag ggacagtatg cccgcggaga caccaagctc      2280
     accgaactcg ccgaccggtt ccgcagcgac ggcccgccca ccctgctgaa ctggacgttg      2340
     atgctgctcg gcttctcagc cgccttccaa ggtagacggg ccgccgcgga ccagttgttc      2400
     gaccaggctg tcgacgtgcc gctgccggta cgcacccact cgccgaacca gtccgtgcgt      2460
     gcccaggcgc tgttccggcg cggcgatcgt agagccgcct accagctact ccgtgcccac      2520
     gtcgaagaac tgctcgacgc cgacaacatg cacggtgcct gcgtcgtatc gatcagcttc      2580
     gtcacgatga tgccggcagt ggcacgcttc gccgagggcg cccgggtcct ggccttcctc      2640
     gacaccgccg gcctgctcga caatgtggcc tgggcggcca tggtcgccga cgcccgggac      2700
     gaactcgcca ccttcgcccc tgcctttgac gagtccacga tcgctgatca acggcaggcc      2760
     ctcgtcgcga tcggcgacac tctcgacgac cttcttgccg aacagaccag ccggccagat      2820
     gctaactcga tctttaacct gctgggcggt ggcatcgacc ccagacgatc atgggaacag      2880
     tcccttgatt ga                                                          2892
//

If you have problems or comments...

PBIL Back to PBIL home page