(data stored in ACNUC7421 zone)

EMBL: CP000667.PE504

CP000667.PE504       Location/Qualifiers
FT   CDS_pept        583825..584169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52989"
FT                   /db_xref="GOA:A4X289"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:A4X289"
FT                   /protein_id="ABP52989.1"
FT                   /translation="MTILRAHIDRFGVGADGRLFRSGRGNVVASSTYSRVWAEARRFSL
FT                   PPERVASPLAGRPYDLRHAGVSLWLNAGLPAPEVAERAGHLVDVLLKVYAKCLDGDRSR
FT                   MNERIEAALN"
     gtgacgattc tgcgagcgca catcgaccgc ttcggggtgg gtgccgacgg gcggctgttc        60
     cgcagcgggc ggggcaacgt ggtggcgtcc tcgacgtact cccgggtgtg ggcggaggcg       120
     cggcggttca gcctgccacc ggagcgggtg gcctctcccc tggccggtcg tccgtacgac       180
     ctgcggcacg ccggggtgtc gctgtggctc aacgcgggct taccggctcc agaagtcgcg       240
     gagcgggccg gccacttggt cgacgtgctc ctcaaggtct acgccaaatg cctcgacggg       300
     gaccgcagcc ggatgaacga acgcatcgaa gcggcgctca actga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page