(data stored in ACNUC7421 zone)

EMBL: CP000667.PE506

CP000667.PE506       Location/Qualifiers
FT   CDS_pept        585090..585476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0507"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52991"
FT                   /db_xref="UniProtKB/TrEMBL:A4X291"
FT                   /protein_id="ABP52991.1"
FT                   /translation="MPRPLAPHGTANRWRTGCGCDECYGAHLDDLFLWRRKKADLRFPA
FT                   PIRNEVLRLIRQGYRPVEAARRVGIHVQTVYARSRIDPAWQGRLDGALMAGRRPDVPHG
FT                   TPTGYRHFWCVCPECRAAHHKPKE"
     atgccaagac ctctcgcccc ccatgggacc gcgaacaggt ggcgcaccgg gtgcgggtgc        60
     gacgagtgct atggagcgca cctggatgac ctgtttttgt ggaggcggaa gaaggcggat       120
     ctgcgtttcc ctgccccaat ccgaaatgag gttttgcgtc tcatccggca gggctacagg       180
     ccggttgagg ctgcacggcg ggtcggaatc cacgtacaaa ctgtttacgc ccgtagcagg       240
     attgatcccg cctggcaggg ccgccttgat ggcgctctga tggcgggccg gcggccagat       300
     gtgccgcacg gcacgcccac gggctatagg catttctggt gcgtctgccc ggagtgccgg       360
     gccgcccatc acaaaccgaa ggaataa                                           387
//

If you have problems or comments...

PBIL Back to PBIL home page