(data stored in ACNUC7421 zone)

EMBL: CP000667.PE509

CP000667.PE509       Location/Qualifiers
FT   CDS_pept        587003..588424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0510"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="PFAM: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52994"
FT                   /db_xref="GOA:A4X294"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4X294"
FT                   /protein_id="ABP52994.1"
FT                   /translation="MNGLTVAATSVVMDGNWLPDPVQPAVQMVFGLALRQLRTEAGLSL
FT                   RALGKAAHYDYTRLSRAERGEHLVDPDVARALDRALQTGGLLGRLRSLEPPVAPARGRA
FT                   PALPRTTFGDGPGDTVKLELRTADGRTVQVSLTRREFAQLLGSGALHAVLPAGVTDLDQ
FT                   ADRLSHSLSGSRVDPEVLGYFQRLLTEHYTADKMLGPRQLLGPVMAQLDVLDTLRRTVR
FT                   LGDTQPVLQLLTQYAEFAGWLHQDGGDLRAAMHWSDRASQWAQAAGDDEMVAYMLVRKS
FT                   NIATLDNDPRAVVALAAAARQVRGDVSPKLLALASQQEARGWAQLHNVQRFRACLDRAS
FT                   DLLATHPAGLRPSSPVYLHGYDLDALEEQSASAYRSAGHTATAAAILERKIRQTPNHLA
FT                   RDQAHQRAKLANLVTAGPDPDPERAAELGIACLDAWRQTGSARIAGELHELKRTLARRW
FT                   PDLPAARPLHDALMA"
     gtgaacgggc tcactgttgc ggcaacatcc gttgtgatgg atggaaactg gctaccggat        60
     ccagttcaac cggccgtgca gatggtcttt ggccttgcct tacggcagct acgcacggag       120
     gcgggtctgt ctctgcgggc gctcggcaag gccgctcact acgactacac acgtctatcc       180
     cgggcagagc gcggcgagca cctcgttgac ccggatgtcg ccagggcgct cgatcgtgcc       240
     ttgcagaccg gcgggctact cggccgtctc cgctctctag agccacccgt tgcccccgct       300
     cgggggcggg cgccagcgct accacggact accttcggcg atggccccgg ggatacggtg       360
     aaactggagc tacggacggc cgatggaagg accgtgcagg tgagcctgac acgacgggag       420
     ttcgcgcagt tgctgggcag tggcgcgctc cacgccgtac tgccggcggg ggtgaccgac       480
     ctcgaccaag ccgaccgact aagccacagc ctcagtgggt cacgagttga cccggaagtt       540
     ctcggctact tccagcggct cctgaccgag cactacaccg cagacaagat gctcgggccc       600
     cggcaacttc tcgggcccgt gatggcacag cttgacgttc tcgacacgct acgccggacc       660
     gtgagacttg gtgacacgca gcccgtgctg caactactga cgcagtacgc cgagttcgcc       720
     gggtggctcc accaggacgg cggtgatctg cgcgccgcca tgcactggtc tgaccgggca       780
     tcccagtggg cgcaggcagc gggcgacgac gaaatggtgg cctacatgct cgtacggaag       840
     agcaacatcg ccacccttga caacgacccg cgcgccgttg ttgccctagc cgccgctgct       900
     cgccaagttc ggggggacgt aagcccaaag ctcctggcgt tggccagcca gcaagaggcg       960
     cgcggctggg cgcaactcca caacgttcag cgcttccggg cgtgcctcga cagggcgtcg      1020
     gacctcctcg caacccaccc ggctgggctg cgccccagtt cgccggtcta cctccacggg      1080
     tacgacctgg acgcactgga agaacagagc gctagcgctt accgcagcgc cggccacacc      1140
     gcaaccgctg cggcgattct cgaacggaag attcgccaga cgccaaacca cctcgcgcgg      1200
     gatcaagccc accagcgggc gaagctggcc aaccttgtca ccgccggccc tgatccggat      1260
     ccggagcggg ccgctgaact gggcatcgcc tgcctggatg catggcgcca gacgggctcg      1320
     gcacggatcg ctggtgagct gcatgaattg aaacgaacgc tggcccgcag gtggccggat      1380
     ctacccgccg cgcgcccact tcacgacgcc ctaatggcct ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page