(data stored in ACNUC7421 zone)

EMBL: CP000667.PE510

CP000667.PE510       Location/Qualifiers
FT   CDS_pept        complement(588475..588921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52995"
FT                   /db_xref="UniProtKB/TrEMBL:A4X295"
FT                   /protein_id="ABP52995.1"
FT                   /translation="MIRAHDPMRPLWRCRACGADWPCQPARLALLDEYRGRRSALLARQ
FT                   GKLLAQASDQLSRLNGTKPDLRERFVDWCWRAEHEDPTIGVFESVDLDFLFRAIEAVIR
FT                   YHWGGWTCPECTDSGCPRLDWVDASLDVLQRRSQGRPEAEGPKR"
     gtgatccgcg cacacgaccc catgcgcccg ctttggcggt gccgggcctg cggcgctgac        60
     tggccctgcc agcccgcgcg gctcgcgttg ctcgatgagt atcgcggcag gaggtcggcc       120
     ctgctggccc gccagggcaa gctcctcgcc caggcatctg atcagctatc ccggctcaac       180
     ggcaccaaac ccgaccttag ggagaggttt gtcgactggt gctggcgggc ggaacacgaa       240
     gaccccacga tcggcgtttt cgagtccgtt gacctggact ttctgtttcg agcgatcgaa       300
     gcagtcattc gctaccactg gggagggtgg acctgccccg agtgcaccga cagtggttgc       360
     cctcggctcg actgggtgga cgcctcgctg gacgtcctgc aacggcgatc gcaaggccgt       420
     ccggaggcgg agggccccaa gcgatag                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page