(data stored in ACNUC7421 zone)

EMBL: CP000667.PE511

CP000667.PE511       Location/Qualifiers
FT   CDS_pept        589581..590393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0512"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52996"
FT                   /db_xref="GOA:A4X296"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A4X296"
FT                   /protein_id="ABP52996.1"
FT                   /translation="MMLRALREAAELSTAQVAEHLASSQPKVSRIENAVSPVSKGDLML
FT                   MLNLYGVTDPDEQDRHWQLARAGRERGWWESYRDVLTGSLGSYIGFENEAESLKIWSWG
FT                   VFPGLLQTEAYARALFASDPVRTEPEEVDRLVAARMQRQQRIAEDGLNLWVVLDESLLH
FT                   RQVGPPGVLAKQLERIAEPPPGVTVQVLPSNVGCHPGLSGAFTIMEFAEFPTIAYRETL
FT                   TGDTPVEAVPDVGRYTLAFDHLRASALSPVESRKAAVSVTRELRKEQQ"
     atgatgctcc gggcgctccg ggaggcggcc gagctcagta cggctcaggt tgcggagcac        60
     cttgccagca gtcagccgaa ggtcagccgg atcgagaacg ccgtatcccc tgtgtccaag       120
     ggggatctga tgctgatgct caacctgtac ggcgtcaccg acccggacga acaagatcgg       180
     cactggcagc ttgcccgcgc tgggcgggag cggggctggt gggagtcgta ccgcgatgtc       240
     ctcaccggct ccttgggctc ctatatcggc ttcgagaacg aagctgagtc cttgaagatc       300
     tggtcctggg gagtctttcc cgggctgctc caaaccgagg cgtacgctcg ggcgctgttc       360
     gcctcggacc ccgtacgaac ggagcccgag gaggtggatc ggctggtggc ggctcgcatg       420
     cagcgtcagc agcggatcgc ggaggacggg ctgaacctgt gggttgtcct ggacgaatcg       480
     ctactacacc gtcaagtcgg gcccccaggc gtgctcgcga agcagcttga gcggatagcc       540
     gaaccaccac caggggtgac ggtgcaggta ctgccatcga acgtcggatg ccatcccggc       600
     ctgagtggcg ctttcacgat catggagttt gctgagttcc caacgatcgc ctaccgcgaa       660
     acactgaccg gggacactcc ggttgaggcc gtccctgacg ttgggcgata caccctggct       720
     tttgatcacc tccgggcttc agccttgagc ccggtagaat cacggaaagc cgccgtgtcg       780
     gtgacgcggg aactacggaa ggaacagcaa tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page