(data stored in ACNUC7421 zone)

EMBL: CP000667.PE512

CP000667.PE512       Location/Qualifiers
FT   CDS_pept        590390..590578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0513"
FT                   /product="protein of unknown function DUF397"
FT                   /note="PFAM: protein of unknown function DUF397"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52997"
FT                   /db_xref="InterPro:IPR007278"
FT                   /db_xref="UniProtKB/TrEMBL:A4X297"
FT                   /protein_id="ABP52997.1"
FT                   /translation="MNLDGATWRKSTRSSGPGNGDCVEVADNLPGVVGVRDSKDPTGPA
FT                   LVFGPEAWQAFVQHARR"
     atgaacctcg acggtgccac gtggcgcaaa tccacccgga gctccgggcc cggtaacgga        60
     gactgcgtgg aggtcgccga caaccttccc ggcgtcgtcg gcgtgcgcga cagcaaggac       120
     ccgaccgggc cggctttggt gttcggtccg gaggcgtggc aggcgttcgt gcagcatgcc       180
     cgacgctga                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page