(data stored in ACNUC7421 zone)

EMBL: CP000667.PE513

CP000667.PE513       Location/Qualifiers
FT   CDS_pept        complement(590639..591148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0514"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52998"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="UniProtKB/TrEMBL:A4X298"
FT                   /protein_id="ABP52998.1"
FT                   /translation="MTYTRVFVEQTLPLMLDGRPGSHGRGPRPSRACRQCDPHRGRERC
FT                   THRCDLSPACISTFEGSEFGICQHVHSGRRTGGCGVCWCLGAHDRRATAASGASTIDAV
FT                   LADIGVAWERSPWLLHMHRRRMYMRYALDWPVGRIAQEEGVSASSVSRTLTAGVDAIVG
FT                   YLEDDT"
     atgacctaca cccgcgtgtt cgttgaacag accttgccgc tcatgctcga cgggcggccc        60
     ggctcgcatg gccgtggacc ccgacccagc agggcctgtc gtcagtgcga ccctcaccgc       120
     ggccgagagc ggtgcacgca ccgttgcgac ctgagccccg cgtgcatcag caccttcgag       180
     ggttctgagt tcggcatctg tcagcacgtg cacagcggtc gtcgcaccgg gggctgtggg       240
     gtctgctggt gcctcggcgc ccatgaccgc agggctaccg ccgcgtcagg cgccagcacg       300
     atcgatgccg tgctggcgga cataggcgtg gcttgggagc gcagcccctg gctcctgcac       360
     atgcatcgcc gcaggatgta tatgcggtat gcgctggact ggccggtggg ccgaatcgcc       420
     caggaggagg gcgtcagcgc tagcagcgtc tcgcgcaccc tcacggccgg cgtggacgcc       480
     atcgtcggct acctggagga cgatacctga                                        510
//

If you have problems or comments...

PBIL Back to PBIL home page