(data stored in ACNUC7421 zone)

EMBL: CP000667.PE514

CP000667.PE514       Location/Qualifiers
FT   CDS_pept        complement(591145..591618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ABP52999"
FT                   /db_xref="UniProtKB/TrEMBL:A4X299"
FT                   /protein_id="ABP52999.1"
FT                   /translation="MNITPRREEIAEVVAILESGAYDGPDAMAADLIRAVAGLLWFRTW
FT                   WVLGARGPRAANFGPFASEAEAVRWGKQVANMAIPAEWGVVQVHGMGRIATNAKGGREG
FT                   GGFGYCVTAGCGCPPYAHAMDKSTRGKCVICGSCDRYQQSERKPAKRAKREPA"
     gtgaatatca ccccgcgccg cgaggagatc gccgaggttg tggcgatcct ggaaagcggc        60
     gcctatgacg gccccgacgc catggctgcg gacctgatca gagcggtcgc cggcctgctg       120
     tggtttcgca cgtggtgggt cctcggcgca cgtggccccc gggcggcgaa cttcggtcca       180
     ttcgcctccg aagcggaggc ggttcggtgg ggcaagcagg tagccaacat ggccataccc       240
     gcagagtggg gcgtggtcca ggttcacggc atgggcagaa tcgcaaccaa cgccaagggc       300
     ggcagggagg gcggtggctt cggctattgc gtgacggccg gctgtggatg cccgccatac       360
     gcacacgcca tggacaagag cacccgaggg aagtgcgtca tctgcggtag ctgtgacaga       420
     taccagcagt cggagcgcaa gccggcaaaa cgtgctaaaa gggagccggc atga             474
//

If you have problems or comments...

PBIL Back to PBIL home page