(data stored in ACNUC7421 zone)

EMBL: CP000667.PE515

CP000667.PE515       Location/Qualifiers
FT   CDS_pept        complement(591615..592094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Strop_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Strop_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABP53000"
FT                   /db_xref="UniProtKB/TrEMBL:A4X2A0"
FT                   /protein_id="ABP53000.1"
FT                   /translation="MIDADWSVLELEGVMPALSRAARNVARRYPGTDLDDLLQDAALMA
FT                   ATRADLVRGWVAHGQLHHLYTDVMRDLEDDVRTQAQRGERSLDAMLEGWRSGEGGVERE
FT                   LADGDGPPPRQRIRNGEYGGKMLGLRWAAPHGAAGGLVATNSPSANPKATSERIR"
     atgatcgatg cggattggtc ggtgctggag ctggagggcg tcatgccagc cctctccagg        60
     gcggcccgga acgtagctcg ccgctacccg ggcaccgacc tggacgacct actccaggac       120
     gccgcactga tggcggccac ccgggcagac cttgtccgag ggtgggttgc ccacggacaa       180
     ctgcaccacc tgtacaccga tgtgatgcgc gacctggagg acgacgttcg cacccaggcg       240
     cagcgcggtg agcgatccct ggacgccatg ttggagggct ggcgcagcgg cgagggtggc       300
     gttgagcggg agctggcgga cggggatggt ccgccaccgc gccagcgcat ccgcaacggg       360
     gagtacggcg gcaagatgct ggggctccgc tgggctgcac ctcatggtgc ggctggcgga       420
     ctggttgcca ccaacagccc gtcagcaaac ccaaaagcca cgagtgagag gattcggtga       480
//

If you have problems or comments...

PBIL Back to PBIL home page